BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30524 (479 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC4F10.02 |||aminopeptidase |Schizosaccharomyces pombe|chr 1||... 26 2.6 SPCC23B6.03c |tel1||ATM checkpoint kinase|Schizosaccharomyces po... 26 2.6 SPBC31E1.04 |pep12||SNARE Pep12|Schizosaccharomyces pombe|chr 2|... 26 2.6 SPCC1450.12 |||conserved fungal protein|Schizosaccharomyces pomb... 25 4.5 SPAC3G9.06 |frs2||phenylalanine-tRNA ligase alpha subunit Frs2 |... 25 5.9 >SPAC4F10.02 |||aminopeptidase |Schizosaccharomyces pombe|chr 1|||Manual Length = 467 Score = 26.2 bits (55), Expect = 2.6 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -2 Query: 79 SYYINTKSKSIVDLSKGERWKGG 11 SY++ SI+ S G++WK G Sbjct: 56 SYFVTRNKSSIIAFSIGKKWKPG 78 >SPCC23B6.03c |tel1||ATM checkpoint kinase|Schizosaccharomyces pombe|chr 3|||Manual Length = 2812 Score = 26.2 bits (55), Expect = 2.6 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = +2 Query: 167 VFFLDYEGQLWNVYCSKQLPSTTRALQLSSARCCDTITQRE 289 +FF D G WN + S ++ + + R CDT T E Sbjct: 1537 LFFSDIMG--WNFFKSPEIADLNHYIPKTDPRLCDTKTYEE 1575 >SPBC31E1.04 |pep12||SNARE Pep12|Schizosaccharomyces pombe|chr 2|||Manual Length = 317 Score = 26.2 bits (55), Expect = 2.6 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = +1 Query: 52 FCFSYLYSNFNSFRLQHA**NNLGSTR 132 FCF ++ F+SFR Q+A NL S R Sbjct: 243 FCFLKSFAMFSSFRSQNANLYNLNSIR 269 >SPCC1450.12 |||conserved fungal protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 821 Score = 25.4 bits (53), Expect = 4.5 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +2 Query: 152 VFTFPVFFLDYEGQLWNVYCSKQLPSTTRA 241 + TFP D + QLWNV L S +++ Sbjct: 72 ILTFPFLDPDSQNQLWNVNFRNLLKSLSKS 101 >SPAC3G9.06 |frs2||phenylalanine-tRNA ligase alpha subunit Frs2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 499 Score = 25.0 bits (52), Expect = 5.9 Identities = 19/42 (45%), Positives = 24/42 (57%), Gaps = 3/42 (7%) Frame = -2 Query: 448 SKTLIDFEKKKLYDIN*L---SLEKANNSSHWLQNEELKLQL 332 SKTL D +K+KL + N + SL K N S LQ E+L L Sbjct: 152 SKTLTDLKKRKLVERNKIMYFSLRKGPNFS--LQIEKLNTDL 191 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,711,470 Number of Sequences: 5004 Number of extensions: 28707 Number of successful extensions: 64 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 64 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 64 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 184020746 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -