BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30522 (824 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 25 3.7 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 24 6.5 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 24 6.5 EF519383-1|ABP68492.1| 506|Anopheles gambiae LRIM1 protein. 23 8.6 EF519381-1|ABP68490.1| 506|Anopheles gambiae LRIM1 protein. 23 8.6 EF519380-1|ABP68489.1| 506|Anopheles gambiae LRIM1 protein. 23 8.6 EF519376-1|ABP68485.1| 506|Anopheles gambiae LRIM1 protein. 23 8.6 EF519374-1|ABP68483.1| 506|Anopheles gambiae LRIM1 protein. 23 8.6 EF519373-1|ABP68482.1| 506|Anopheles gambiae LRIM1 protein. 23 8.6 EF519372-1|ABP68481.1| 506|Anopheles gambiae LRIM1 protein. 23 8.6 EF519371-1|ABP68480.1| 506|Anopheles gambiae LRIM1 protein. 23 8.6 EF519369-1|ABP68478.1| 506|Anopheles gambiae LRIM1 protein. 23 8.6 EF519367-1|ABP68476.1| 506|Anopheles gambiae LRIM1 protein. 23 8.6 EF519366-1|ABP68475.1| 506|Anopheles gambiae LRIM1 protein. 23 8.6 EF519363-1|ABP68472.1| 503|Anopheles gambiae LRIM1 protein. 23 8.6 EF519362-1|ABP68471.1| 506|Anopheles gambiae LRIM1 protein. 23 8.6 EF519361-1|ABP68470.1| 497|Anopheles gambiae LRIM1 protein. 23 8.6 EF519360-1|ABP68469.1| 499|Anopheles gambiae LRIM1 protein. 23 8.6 EF519359-1|ABP68468.1| 506|Anopheles gambiae LRIM1 protein. 23 8.6 EF519358-1|ABP68467.1| 497|Anopheles gambiae LRIM1 protein. 23 8.6 EF519357-1|ABP68466.1| 506|Anopheles gambiae LRIM1 protein. 23 8.6 EF519356-1|ABP68465.1| 500|Anopheles gambiae LRIM1 protein. 23 8.6 EF519355-1|ABP68464.1| 506|Anopheles gambiae LRIM1 protein. 23 8.6 EF519354-1|ABP68463.1| 506|Anopheles gambiae LRIM1 protein. 23 8.6 EF519353-1|ABP68462.1| 470|Anopheles gambiae LRIM1 protein. 23 8.6 EF519352-1|ABP68461.1| 448|Anopheles gambiae LRIM1 protein. 23 8.6 EF519351-1|ABP68460.1| 486|Anopheles gambiae LRIM1 protein. 23 8.6 EF519350-1|ABP68459.1| 421|Anopheles gambiae LRIM1 protein. 23 8.6 EF519349-1|ABP68458.1| 486|Anopheles gambiae LRIM1 protein. 23 8.6 EF519348-1|ABP68457.1| 503|Anopheles gambiae LRIM1 protein. 23 8.6 EF519347-1|ABP68456.1| 470|Anopheles gambiae LRIM1 protein. 23 8.6 AY500851-1|AAS77205.1| 605|Anopheles gambiae G-protein coupled ... 23 8.6 AY423354-1|AAQ94040.1| 112|Anopheles gambiae defender against p... 23 8.6 AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. 23 8.6 AY344813-1|AAR03841.1| 286|Anopheles gambiae LRR Toll protein. 23 8.6 AY344812-1|AAR03840.1| 286|Anopheles gambiae LRR Toll protein. 23 8.6 AY344811-1|AAR03839.1| 286|Anopheles gambiae LRR Toll protein. 23 8.6 AY344810-1|AAR03838.1| 286|Anopheles gambiae LRR Toll protein. 23 8.6 AY344809-1|AAR03837.1| 286|Anopheles gambiae LRR Toll protein. 23 8.6 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 24.6 bits (51), Expect = 3.7 Identities = 13/39 (33%), Positives = 18/39 (46%) Frame = +2 Query: 293 VGGNGFVNISKRWKGDNVQLLGPNCSLTVAGKLKSAPSY 409 VGG +V ISK K N + N + ++G L Y Sbjct: 910 VGGGEYVEISKGRKTPNELTVRRNLATVLSGNLNEETEY 948 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 23.8 bits (49), Expect = 6.5 Identities = 8/21 (38%), Positives = 15/21 (71%) Frame = -2 Query: 478 HHECENRFNDVVQVLAEWRQL 416 H + + +F+D+ Q + E+RQL Sbjct: 3195 HSQIDKQFHDLKQTVQEYRQL 3215 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 23.8 bits (49), Expect = 6.5 Identities = 8/21 (38%), Positives = 15/21 (71%) Frame = -2 Query: 478 HHECENRFNDVVQVLAEWRQL 416 H + + +F+D+ Q + E+RQL Sbjct: 3198 HSQIDKQFHDLKQTVQEYRQL 3218 >EF519383-1|ABP68492.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 8.6 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = +2 Query: 29 RITYLNFKLKIVDNLVFCNLLTTFPYTKNEEVQY 130 R+ YL+ KL +D + F L + ++ +QY Sbjct: 167 RVQYLDLKLNEIDTVNFAELAASSDTLEHLNLQY 200 >EF519381-1|ABP68490.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 8.6 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = +2 Query: 29 RITYLNFKLKIVDNLVFCNLLTTFPYTKNEEVQY 130 R+ YL+ KL +D + F L + ++ +QY Sbjct: 167 RVQYLDLKLNEIDTVNFAELAASSDTLEHLNLQY 200 >EF519380-1|ABP68489.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 8.6 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = +2 Query: 29 RITYLNFKLKIVDNLVFCNLLTTFPYTKNEEVQY 130 R+ YL+ KL +D + F L + ++ +QY Sbjct: 167 RVQYLDLKLNEIDTVNFAELAASSDTLEHLNLQY 200 >EF519376-1|ABP68485.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 8.6 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = +2 Query: 29 RITYLNFKLKIVDNLVFCNLLTTFPYTKNEEVQY 130 R+ YL+ KL +D + F L + ++ +QY Sbjct: 167 RVQYLDLKLNEIDTVNFAELAASSDTLEHLNLQY 200 >EF519374-1|ABP68483.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 8.6 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = +2 Query: 29 RITYLNFKLKIVDNLVFCNLLTTFPYTKNEEVQY 130 R+ YL+ KL +D + F L + ++ +QY Sbjct: 167 RVQYLDLKLNEIDTVNFAELAASSDTLEHLNLQY 200 >EF519373-1|ABP68482.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 8.6 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = +2 Query: 29 RITYLNFKLKIVDNLVFCNLLTTFPYTKNEEVQY 130 R+ YL+ KL +D + F L + ++ +QY Sbjct: 167 RVQYLDLKLNEIDTVNFAELAASSDTLEHLNLQY 200 >EF519372-1|ABP68481.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 8.6 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = +2 Query: 29 RITYLNFKLKIVDNLVFCNLLTTFPYTKNEEVQY 130 R+ YL+ KL +D + F L + ++ +QY Sbjct: 167 RVQYLDLKLNEIDTVNFAELAASSDTLEHLNLQY 200 >EF519371-1|ABP68480.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 8.6 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = +2 Query: 29 RITYLNFKLKIVDNLVFCNLLTTFPYTKNEEVQY 130 R+ YL+ KL +D + F L + ++ +QY Sbjct: 167 RVQYLDLKLNEIDTVNFAELAASSDTLEHLNLQY 200 >EF519369-1|ABP68478.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 8.6 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = +2 Query: 29 RITYLNFKLKIVDNLVFCNLLTTFPYTKNEEVQY 130 R+ YL+ KL +D + F L + ++ +QY Sbjct: 167 RVQYLDLKLNEIDTVNFAELAASSDTLEHLNLQY 200 >EF519367-1|ABP68476.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 8.6 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = +2 Query: 29 RITYLNFKLKIVDNLVFCNLLTTFPYTKNEEVQY 130 R+ YL+ KL +D + F L + ++ +QY Sbjct: 167 RVQYLDLKLNEIDTVNFAELAASSDTLEHLNLQY 200 >EF519366-1|ABP68475.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 8.6 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = +2 Query: 29 RITYLNFKLKIVDNLVFCNLLTTFPYTKNEEVQY 130 R+ YL+ KL +D + F L + ++ +QY Sbjct: 167 RVQYLDLKLNEIDTVNFAELAASSDTLEHLNLQY 200 >EF519363-1|ABP68472.1| 503|Anopheles gambiae LRIM1 protein. Length = 503 Score = 23.4 bits (48), Expect = 8.6 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = +2 Query: 29 RITYLNFKLKIVDNLVFCNLLTTFPYTKNEEVQY 130 R+ YL+ KL +D + F L + ++ +QY Sbjct: 167 RVQYLDLKLNEIDTVNFAELAASSDTLEHLNLQY 200 >EF519362-1|ABP68471.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 8.6 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = +2 Query: 29 RITYLNFKLKIVDNLVFCNLLTTFPYTKNEEVQY 130 R+ YL+ KL +D + F L + ++ +QY Sbjct: 167 RVQYLDLKLNEIDTVNFAELAASSDTLEHLNLQY 200 >EF519361-1|ABP68470.1| 497|Anopheles gambiae LRIM1 protein. Length = 497 Score = 23.4 bits (48), Expect = 8.6 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = +2 Query: 29 RITYLNFKLKIVDNLVFCNLLTTFPYTKNEEVQY 130 R+ YL+ KL +D + F L + ++ +QY Sbjct: 167 RVQYLDLKLNEIDTVNFAELAASSDTLEHLNLQY 200 >EF519360-1|ABP68469.1| 499|Anopheles gambiae LRIM1 protein. Length = 499 Score = 23.4 bits (48), Expect = 8.6 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = +2 Query: 29 RITYLNFKLKIVDNLVFCNLLTTFPYTKNEEVQY 130 R+ YL+ KL +D + F L + ++ +QY Sbjct: 167 RVQYLDLKLNEIDTVNFAELAASSDTLEHLNLQY 200 >EF519359-1|ABP68468.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 8.6 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = +2 Query: 29 RITYLNFKLKIVDNLVFCNLLTTFPYTKNEEVQY 130 R+ YL+ KL +D + F L + ++ +QY Sbjct: 167 RVQYLDLKLNEIDTVNFAELAASSDTLEHLNLQY 200 >EF519358-1|ABP68467.1| 497|Anopheles gambiae LRIM1 protein. Length = 497 Score = 23.4 bits (48), Expect = 8.6 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = +2 Query: 29 RITYLNFKLKIVDNLVFCNLLTTFPYTKNEEVQY 130 R+ YL+ KL +D + F L + ++ +QY Sbjct: 167 RVQYLDLKLNEIDTVNFAELAASSDTLEHLNLQY 200 >EF519357-1|ABP68466.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 8.6 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = +2 Query: 29 RITYLNFKLKIVDNLVFCNLLTTFPYTKNEEVQY 130 R+ YL+ KL +D + F L + ++ +QY Sbjct: 167 RVQYLDLKLNEIDTVNFAELAASSDTLEHLNLQY 200 >EF519356-1|ABP68465.1| 500|Anopheles gambiae LRIM1 protein. Length = 500 Score = 23.4 bits (48), Expect = 8.6 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = +2 Query: 29 RITYLNFKLKIVDNLVFCNLLTTFPYTKNEEVQY 130 R+ YL+ KL +D + F L + ++ +QY Sbjct: 167 RVQYLDLKLNEIDTVNFAELAASSDTLEHLNLQY 200 >EF519355-1|ABP68464.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 8.6 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = +2 Query: 29 RITYLNFKLKIVDNLVFCNLLTTFPYTKNEEVQY 130 R+ YL+ KL +D + F L + ++ +QY Sbjct: 167 RVQYLDLKLNEIDTVNFAELAASSDTLEHLNLQY 200 >EF519354-1|ABP68463.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 8.6 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = +2 Query: 29 RITYLNFKLKIVDNLVFCNLLTTFPYTKNEEVQY 130 R+ YL+ KL +D + F L + ++ +QY Sbjct: 167 RVQYLDLKLNEIDTVNFAELAASSDTLEHLNLQY 200 >EF519353-1|ABP68462.1| 470|Anopheles gambiae LRIM1 protein. Length = 470 Score = 23.4 bits (48), Expect = 8.6 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = +2 Query: 29 RITYLNFKLKIVDNLVFCNLLTTFPYTKNEEVQY 130 R+ YL+ KL +D + F L + ++ +QY Sbjct: 167 RVQYLDLKLNEIDTVNFAELAASSDTLEHLNLQY 200 >EF519352-1|ABP68461.1| 448|Anopheles gambiae LRIM1 protein. Length = 448 Score = 23.4 bits (48), Expect = 8.6 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = +2 Query: 29 RITYLNFKLKIVDNLVFCNLLTTFPYTKNEEVQY 130 R+ YL+ KL +D + F L + ++ +QY Sbjct: 167 RVQYLDLKLNEIDTVNFAELAASSDTLEHLNLQY 200 >EF519351-1|ABP68460.1| 486|Anopheles gambiae LRIM1 protein. Length = 486 Score = 23.4 bits (48), Expect = 8.6 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = +2 Query: 29 RITYLNFKLKIVDNLVFCNLLTTFPYTKNEEVQY 130 R+ YL+ KL +D + F L + ++ +QY Sbjct: 167 RVQYLDLKLNEIDTVNFAELAASSDTLEHLNLQY 200 >EF519350-1|ABP68459.1| 421|Anopheles gambiae LRIM1 protein. Length = 421 Score = 23.4 bits (48), Expect = 8.6 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = +2 Query: 29 RITYLNFKLKIVDNLVFCNLLTTFPYTKNEEVQY 130 R+ YL+ KL +D + F L + ++ +QY Sbjct: 167 RVQYLDLKLNEIDTVNFAELAASSDTLEHLNLQY 200 >EF519349-1|ABP68458.1| 486|Anopheles gambiae LRIM1 protein. Length = 486 Score = 23.4 bits (48), Expect = 8.6 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = +2 Query: 29 RITYLNFKLKIVDNLVFCNLLTTFPYTKNEEVQY 130 R+ YL+ KL +D + F L + ++ +QY Sbjct: 167 RVQYLDLKLNEIDTVNFAELAASSDTLEHLNLQY 200 >EF519348-1|ABP68457.1| 503|Anopheles gambiae LRIM1 protein. Length = 503 Score = 23.4 bits (48), Expect = 8.6 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = +2 Query: 29 RITYLNFKLKIVDNLVFCNLLTTFPYTKNEEVQY 130 R+ YL+ KL +D + F L + ++ +QY Sbjct: 167 RVQYLDLKLNEIDTVNFAELAASSDTLEHLNLQY 200 >EF519347-1|ABP68456.1| 470|Anopheles gambiae LRIM1 protein. Length = 470 Score = 23.4 bits (48), Expect = 8.6 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = +2 Query: 29 RITYLNFKLKIVDNLVFCNLLTTFPYTKNEEVQY 130 R+ YL+ KL +D + F L + ++ +QY Sbjct: 167 RVQYLDLKLNEIDTVNFAELAASSDTLEHLNLQY 200 >AY500851-1|AAS77205.1| 605|Anopheles gambiae G-protein coupled receptor 3 protein. Length = 605 Score = 23.4 bits (48), Expect = 8.6 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +1 Query: 727 HPKNFSKCW 753 HP NFS CW Sbjct: 330 HPMNFSGCW 338 >AY423354-1|AAQ94040.1| 112|Anopheles gambiae defender against programmed cell death protein. Length = 112 Score = 23.4 bits (48), Expect = 8.6 Identities = 9/15 (60%), Positives = 13/15 (86%) Frame = -1 Query: 773 LRLGNSPQHLEKFFG 729 LRL ++PQ+ E+FFG Sbjct: 72 LRLQSNPQNKEQFFG 86 >AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.4 bits (48), Expect = 8.6 Identities = 10/24 (41%), Positives = 11/24 (45%) Frame = -3 Query: 306 PFPPTRLMTPWFSVTSTHNRCQPP 235 P PPT T W T+T PP Sbjct: 212 PPPPTTTTTVWIDPTATTTTHVPP 235 >AY344813-1|AAR03841.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 23.4 bits (48), Expect = 8.6 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = +2 Query: 29 RITYLNFKLKIVDNLVFCNLLTTFPYTKNEEVQY 130 R+ YL+ KL +D + F L + ++ +QY Sbjct: 92 RVQYLDLKLNEIDTVNFAELAASSDTLEHLNLQY 125 >AY344812-1|AAR03840.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 23.4 bits (48), Expect = 8.6 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = +2 Query: 29 RITYLNFKLKIVDNLVFCNLLTTFPYTKNEEVQY 130 R+ YL+ KL +D + F L + ++ +QY Sbjct: 92 RVQYLDLKLNEIDTVNFAELAASSDTLEHLNLQY 125 >AY344811-1|AAR03839.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 23.4 bits (48), Expect = 8.6 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = +2 Query: 29 RITYLNFKLKIVDNLVFCNLLTTFPYTKNEEVQY 130 R+ YL+ KL +D + F L + ++ +QY Sbjct: 92 RVQYLDLKLNEIDTVNFAELAASSDTLEHLNLQY 125 >AY344810-1|AAR03838.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 23.4 bits (48), Expect = 8.6 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = +2 Query: 29 RITYLNFKLKIVDNLVFCNLLTTFPYTKNEEVQY 130 R+ YL+ KL +D + F L + ++ +QY Sbjct: 92 RVQYLDLKLNEIDTVNFAELAASSDTLEHLNLQY 125 >AY344809-1|AAR03837.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 23.4 bits (48), Expect = 8.6 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = +2 Query: 29 RITYLNFKLKIVDNLVFCNLLTTFPYTKNEEVQY 130 R+ YL+ KL +D + F L + ++ +QY Sbjct: 92 RVQYLDLKLNEIDTVNFAELAASSDTLEHLNLQY 125 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 917,035 Number of Sequences: 2352 Number of extensions: 21097 Number of successful extensions: 120 Number of sequences better than 10.0: 39 Number of HSP's better than 10.0 without gapping: 103 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 120 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 87734433 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -