BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30521 (866 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY873916-1|AAW67572.1| 377|Tribolium castaneum chitinase 6 prot... 24 1.3 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 23 4.1 >AY873916-1|AAW67572.1| 377|Tribolium castaneum chitinase 6 protein. Length = 377 Score = 24.2 bits (50), Expect = 1.3 Identities = 15/38 (39%), Positives = 19/38 (50%), Gaps = 4/38 (10%) Frame = +3 Query: 297 NPNPVANPKQFPKKNNL----LTENETDTKHSRKKSKN 398 NP VA Q+ K NNL + ETD H+ +KN Sbjct: 327 NPKSVALKAQYAKDNNLAGVMIWSIETDDLHATCGTKN 364 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 22.6 bits (46), Expect = 4.1 Identities = 10/34 (29%), Positives = 16/34 (47%) Frame = -2 Query: 823 PNFSRGSFWLGGWKKAFLERQLT*FGKPWLKTGF 722 PN++ + W GWK + L +P +K F Sbjct: 668 PNYAEVTDWYTGWKNMLSDELL---AQPTIKENF 698 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 205,862 Number of Sequences: 336 Number of extensions: 4562 Number of successful extensions: 11 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 23893023 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -