BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30520 (617 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g39740.1 68418.m04813 60S ribosomal protein L5 (RPL5B) riboso... 92 3e-19 At3g25520.1 68416.m03173 60S ribosomal protein L5 similar to 60S... 88 4e-18 At5g60960.1 68418.m07647 pentatricopeptide (PPR) repeat-containi... 35 0.038 At2g46790.2 68415.m05838 pseudo-response regulator 9 (APRR9) / t... 35 0.050 At2g46790.1 68415.m05837 pseudo-response regulator 9 (APRR9) / t... 35 0.050 At2g46670.1 68415.m05824 pseudo-response regulator, putative / t... 35 0.050 At4g40020.1 68417.m05666 hypothetical protein 33 0.20 At1g03780.2 68414.m00358 targeting protein-related similar to mi... 33 0.20 At1g14500.1 68414.m01719 ankyrin repeat family protein contains ... 31 0.61 At1g14480.1 68414.m01717 ankyrin repeat family protein contains ... 31 0.61 At2g10608.1 68415.m01121 hypothetical protein 30 1.1 At5g40340.1 68418.m04894 PWWP domain-containing protein KED, Nic... 29 1.9 At4g33690.1 68417.m04785 expressed protein 29 2.5 At1g67590.1 68414.m07700 remorin family protein contains Pfam do... 29 2.5 At5g51340.1 68418.m06366 expressed protein 29 3.3 At1g44910.1 68414.m05146 FF domain-containing protein / WW domai... 29 3.3 At5g41790.1 68418.m05088 COP1-interactive protein 1 / CIP1 almos... 28 4.3 At1g15290.1 68414.m01830 tetratricopeptide repeat (TPR)-containi... 28 4.3 At3g05060.1 68416.m00549 SAR DNA-binding protein, putative stron... 28 5.7 At3g27025.1 68416.m03381 expressed protein 27 7.5 At1g56660.1 68414.m06516 expressed protein 27 7.5 At1g29000.1 68414.m03546 heavy-metal-associated domain-containin... 27 7.5 At1g09810.1 68414.m01101 expressed protein contains Pfam profile... 27 7.5 At5g65390.1 68418.m08224 arabinogalactan-protein (AGP7) 27 10.0 At5g49430.1 68418.m06116 transducin family protein / WD-40 repea... 27 10.0 At3g54570.1 68416.m06038 calmodulin-binding protein-related cont... 27 10.0 >At5g39740.1 68418.m04813 60S ribosomal protein L5 (RPL5B) ribosomal protein L5, rice Length = 301 Score = 91.9 bits (218), Expect = 3e-19 Identities = 42/98 (42%), Positives = 66/98 (67%) Frame = +3 Query: 249 QKFNAEVHRAHIFGLHVAEYMRSLEQDDEDSFKRQFSKYIKLGVTADAIEAIYKKAHEAI 428 ++ +AE+HR +I+G HV+ YM+ L +D+ + + FS YIK GV A++IE +YKK H AI Sbjct: 187 KQLDAEIHRNYIYGGHVSNYMKLLGEDEPEKLQTHFSAYIKKGVEAESIEEMYKKVHAAI 246 Query: 429 RADPSHKKKELKKDSVKQKRWEQTQAKLAERKNRIKQK 542 RA+P+HKK E K + KR+ + ERKN++ ++ Sbjct: 247 RAEPNHKKTE-KSAPKEHKRYNLKKLTYEERKNKLIER 283 Score = 82.6 bits (195), Expect = 2e-16 Identities = 42/84 (50%), Positives = 54/84 (64%) Frame = +1 Query: 1 LARRLLQRXXXXXXXXXXXXXXXXEYNVEPVDNGPGAFRCYLDVGLARTTTGARVFGAMK 180 LARR+L+ +++VEP D+ FR LDVGL RTTTG RVFGA+K Sbjct: 105 LARRVLKMLEMDDEYEGNVEATGEDFSVEPTDSRR-PFRALLDVGLIRTTTGNRVFGALK 163 Query: 181 GAVDGGLNVPHSIKRFPGYDAESK 252 GA+DGGL++PHS KRF G+ E+K Sbjct: 164 GALDGGLDIPHSDKRFAGFHKENK 187 >At3g25520.1 68416.m03173 60S ribosomal protein L5 similar to 60S ribosomal protein L5 GB:P49625 from [Oryza sativa] Length = 301 Score = 88.2 bits (209), Expect = 4e-18 Identities = 41/98 (41%), Positives = 65/98 (66%) Frame = +3 Query: 249 QKFNAEVHRAHIFGLHVAEYMRSLEQDDEDSFKRQFSKYIKLGVTADAIEAIYKKAHEAI 428 ++ +AE+HR +I+G HV+ YM+ L +D+ + + FS YIK GV A++IE +YKK H AI Sbjct: 187 KQLDAEIHRNYIYGGHVSNYMKLLGEDEPEKLQTHFSAYIKKGVEAESIEELYKKVHAAI 246 Query: 429 RADPSHKKKELKKDSVKQKRWEQTQAKLAERKNRIKQK 542 RADP + KK +K + KR+ + ERKN++ ++ Sbjct: 247 RADP-NPKKTVKPAPKQHKRYNLKKLTYEERKNKLIER 283 Score = 82.6 bits (195), Expect = 2e-16 Identities = 42/84 (50%), Positives = 54/84 (64%) Frame = +1 Query: 1 LARRLLQRXXXXXXXXXXXXXXXXEYNVEPVDNGPGAFRCYLDVGLARTTTGARVFGAMK 180 LARR+L+ +++VEP D+ FR LDVGL RTTTG RVFGA+K Sbjct: 105 LARRVLKMLEMDDEYEGNVEATGEDFSVEPTDSRR-PFRALLDVGLIRTTTGNRVFGALK 163 Query: 181 GAVDGGLNVPHSIKRFPGYDAESK 252 GA+DGGL++PHS KRF G+ E+K Sbjct: 164 GALDGGLDIPHSDKRFAGFHKENK 187 >At5g60960.1 68418.m07647 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 521 Score = 35.1 bits (77), Expect = 0.038 Identities = 17/45 (37%), Positives = 24/45 (53%) Frame = +3 Query: 429 RADPSHKKKELKKDSVKQKRWEQTQAKLAERKNRIKQKKASFIKR 563 R DP KK+ K+ K+ E K A +K R+KQ SF+K+ Sbjct: 468 RVDPRFMKKKTKEVDSNVKKRETLPEKTARKKKRLKQINMSFVKK 512 >At2g46790.2 68415.m05838 pseudo-response regulator 9 (APRR9) / timing of CAB expression 1-like protein (TL1) identical to pseudo-response regulator 9 GI:10281000 from [Arabidopsis thaliana], timing of CAB expression 1-like protein [Arabidopsis thaliana] GI:9247022; contains Pfam profile PF00072: Response regulator receiver domain; identical to cDNA timing of CAB expression 1-like protein GI:9247021 Length = 351 Score = 34.7 bits (76), Expect = 0.050 Identities = 19/57 (33%), Positives = 32/57 (56%) Frame = +3 Query: 393 IEAIYKKAHEAIRADPSHKKKELKKDSVKQKRWEQTQAKLAERKNRIKQKKASFIKR 563 +EA + +E I S +K +++S KQ RW ++Q + A K R+K+K F K+ Sbjct: 264 VEAGSQSTNEGIAGQSSSTEKPKEEESAKQ-RWSRSQREAALMKFRLKRKDRCFDKK 319 >At2g46790.1 68415.m05837 pseudo-response regulator 9 (APRR9) / timing of CAB expression 1-like protein (TL1) identical to pseudo-response regulator 9 GI:10281000 from [Arabidopsis thaliana], timing of CAB expression 1-like protein [Arabidopsis thaliana] GI:9247022; contains Pfam profile PF00072: Response regulator receiver domain; identical to cDNA timing of CAB expression 1-like protein GI:9247021 Length = 468 Score = 34.7 bits (76), Expect = 0.050 Identities = 19/57 (33%), Positives = 32/57 (56%) Frame = +3 Query: 393 IEAIYKKAHEAIRADPSHKKKELKKDSVKQKRWEQTQAKLAERKNRIKQKKASFIKR 563 +EA + +E I S +K +++S KQ RW ++Q + A K R+K+K F K+ Sbjct: 381 VEAGSQSTNEGIAGQSSSTEKPKEEESAKQ-RWSRSQREAALMKFRLKRKDRCFDKK 436 >At2g46670.1 68415.m05824 pseudo-response regulator, putative / timing of CAB expression 1-like protein, putative similar to pseudo-response regulator 9 [Arabidopsis thaliana] GI:10281000, timing of CAB expression 1-like protein [Arabidopsis thaliana] GI:9247022 Length = 183 Score = 34.7 bits (76), Expect = 0.050 Identities = 19/57 (33%), Positives = 32/57 (56%) Frame = +3 Query: 393 IEAIYKKAHEAIRADPSHKKKELKKDSVKQKRWEQTQAKLAERKNRIKQKKASFIKR 563 +EA + +E I S +K +++S KQ RW ++Q + A K R+K+K F K+ Sbjct: 96 VEAGSQSTNEGIAGQSSSTEKPKEEESAKQ-RWSRSQREAALMKFRLKRKDRCFDKK 151 >At4g40020.1 68417.m05666 hypothetical protein Length = 615 Score = 32.7 bits (71), Expect = 0.20 Identities = 24/89 (26%), Positives = 47/89 (52%) Frame = +3 Query: 297 VAEYMRSLEQDDEDSFKRQFSKYIKLGVTADAIEAIYKKAHEAIRADPSHKKKELKKDSV 476 ++E ++E++ + S RQ S + + +E + KK E + + + K+ KK+S Sbjct: 365 LSEIEVAMEEEKQRSLNRQES------MPKEVVEVVEKKIEEKEKKEEKKENKKEKKESK 418 Query: 477 KQKRWEQTQAKLAERKNRIKQKKASFIKR 563 K+K+ E ++ K E K + +Q +F KR Sbjct: 419 KEKK-EHSEKK--EDKEKKEQTHQNFDKR 444 >At1g03780.2 68414.m00358 targeting protein-related similar to microtubule-associated protein / targeting protein for Xklp2 ((TPX2) GI:8926138) {Homo sapiens}; similar to Restricted expression proliferation associated protein 100 (p100) (Differentially expressed in lung cells 2) (DIL-2) (Targeting protein for Xklp2) (C20orf1 protein) (C20orf2 protein) (Protein FLS353)(SP:Q9ULW0) {Homo sapiens} Length = 725 Score = 32.7 bits (71), Expect = 0.20 Identities = 18/48 (37%), Positives = 28/48 (58%), Gaps = 1/48 (2%) Frame = +3 Query: 417 HEAI-RADPSHKKKELKKDSVKQKRWEQTQAKLAERKNRIKQKKASFI 557 H A+ RAD HK KE K++ K+ R E AK+ E + +KQ + + + Sbjct: 620 HRAVERADFDHKIKE-KENQYKRYREESEAAKMVEEERALKQMRKTMV 666 >At1g14500.1 68414.m01719 ankyrin repeat family protein contains Pfam domain, PF00023: Ankyrin repeat Length = 436 Score = 31.1 bits (67), Expect = 0.61 Identities = 19/59 (32%), Positives = 30/59 (50%), Gaps = 2/59 (3%) Frame = -2 Query: 559 LMKEAFFCLILFFLSANLACVCSQRFCLTE--SFFNSFFLWDGSARMASWAFL*MASIA 389 +MK+ FF ++ + C FCL S F ++F W G++ S+A L MA I+ Sbjct: 325 VMKQTFFIVLWVSNTIGFCCALLYTFCLLPIGSLFTTWFFWIGASLGVSYA-LAMAIIS 382 >At1g14480.1 68414.m01717 ankyrin repeat family protein contains Pfam domain, PF00023: Ankyrin repeat Length = 412 Score = 31.1 bits (67), Expect = 0.61 Identities = 22/67 (32%), Positives = 33/67 (49%), Gaps = 2/67 (2%) Frame = -2 Query: 583 ASA*ACSLLMKEAFFCLILFFLSANLACVCSQRFCLTE--SFFNSFFLWDGSARMASWAF 410 A+A A S++MK+ FF L+ + C FCL F +F + G+ S+A Sbjct: 293 ANANAGSVVMKQTFFILLWISNTVGFCCAVFYTFCLIPLGQLFTIWFFYIGTCLCISYA- 351 Query: 409 L*MASIA 389 L MA I+ Sbjct: 352 LAMAVIS 358 >At2g10608.1 68415.m01121 hypothetical protein Length = 135 Score = 30.3 bits (65), Expect = 1.1 Identities = 18/58 (31%), Positives = 35/58 (60%), Gaps = 1/58 (1%) Frame = -2 Query: 532 ILFFLSANLACVCSQRFCLTESFFN-SFFLWDGSARMASWAFL*MASIASAVTPSFMY 362 +L+ + ++A VC + FCL S+ S +L+ GS R+ ++F+ + S S++ +F Y Sbjct: 49 LLYSFNVDVAIVCVEVFCLASSYVEASMWLFCGSVRLL-FSFV-VGSAYSSLQQNFHY 104 >At5g40340.1 68418.m04894 PWWP domain-containing protein KED, Nicotiana tabacum, EMBL:AB009883 Length = 1008 Score = 29.5 bits (63), Expect = 1.9 Identities = 19/59 (32%), Positives = 30/59 (50%), Gaps = 4/59 (6%) Frame = +3 Query: 396 EAIYKKAHEAIRADPSHKKKELKKDS----VKQKRWEQTQAKLAERKNRIKQKKASFIK 560 E K+A+E+ + + KK E KK S QK ++ K +RKN +KKA ++ Sbjct: 747 EETQKEANESTKKERKRKKSESKKQSDGEEETQKEPSESTKKERKRKNPESKKKAEAVE 805 >At4g33690.1 68417.m04785 expressed protein Length = 281 Score = 29.1 bits (62), Expect = 2.5 Identities = 15/38 (39%), Positives = 22/38 (57%) Frame = +3 Query: 396 EAIYKKAHEAIRADPSHKKKELKKDSVKQKRWEQTQAK 509 E +YK+AH R HKKK KK K+K+ ++ + K Sbjct: 243 EEVYKRAH---RKRKEHKKKLSKKHKSKEKKRDRKKRK 277 >At1g67590.1 68414.m07700 remorin family protein contains Pfam domain, PF03763: Remorin, C-terminal region Length = 347 Score = 29.1 bits (62), Expect = 2.5 Identities = 14/45 (31%), Positives = 26/45 (57%) Frame = +3 Query: 417 HEAIRADPSHKKKELKKDSVKQKRWEQTQAKLAERKNRIKQKKAS 551 HE +A+ KK E+K + +K + E+ KLA K ++++A+ Sbjct: 261 HEKRKAEMEMKKMEVKAERMKARAEEKLANKLAATKRIAEERRAN 305 >At5g51340.1 68418.m06366 expressed protein Length = 726 Score = 28.7 bits (61), Expect = 3.3 Identities = 9/29 (31%), Positives = 20/29 (68%) Frame = +3 Query: 447 KKKELKKDSVKQKRWEQTQAKLAERKNRI 533 K E++ + ++K+W++ Q++LAE + I Sbjct: 628 KGNEMENEEFRKKKWDELQSRLAEARGSI 656 >At1g44910.1 68414.m05146 FF domain-containing protein / WW domain-containing protein contains Pfam profiles PF01846: FF domain, PF00397: WW domain Length = 946 Score = 28.7 bits (61), Expect = 3.3 Identities = 16/79 (20%), Positives = 38/79 (48%) Frame = +3 Query: 327 DDEDSFKRQFSKYIKLGVTADAIEAIYKKAHEAIRADPSHKKKELKKDSVKQKRWEQTQA 506 ++ ++ + + G+ + I ++ +KA E R K ++ K+ K+KR ++ + Sbjct: 765 EESQEYRSIGDESVSQGLFEEYITSLQEKAKEKERKRDEEKVRKEKERDEKEKRKDKDKE 824 Query: 507 KLAERKNRIKQKKASFIKR 563 + + + R K+K KR Sbjct: 825 RREKEREREKEKGKERSKR 843 >At5g41790.1 68418.m05088 COP1-interactive protein 1 / CIP1 almost identical to CIP1 (GI:836950) [Arabidopsis thaliana] Length = 1305 Score = 28.3 bits (60), Expect = 4.3 Identities = 19/75 (25%), Positives = 37/75 (49%), Gaps = 4/75 (5%) Frame = +3 Query: 336 DSFKRQFSKYIK-LGVTADAIEAIYKKAHEAIRADPSHKK---KELKKDSVKQKRWEQTQ 503 ++ KR S +K L ++ E K+ ++ + + KK +++ + S+K KR E T Sbjct: 565 EAHKRDSSSQVKELEARVESAEEQVKELNQNLNSSEEEKKILSQQISEMSIKIKRAESTI 624 Query: 504 AKLAERKNRIKQKKA 548 +L+ R+K A Sbjct: 625 QELSSESERLKGSHA 639 >At1g15290.1 68414.m01830 tetratricopeptide repeat (TPR)-containing protein ESTs gb|F20110 and gb|F20109 come from this gene; contains Pfam profile PF00515: TPR Domain Length = 1558 Score = 28.3 bits (60), Expect = 4.3 Identities = 12/46 (26%), Positives = 21/46 (45%) Frame = +3 Query: 246 IQKFNAEVHRAHIFGLHVAEYMRSLEQDDEDSFKRQFSKYIKLGVT 383 + E HR H G V L+ DD +S++ + +K+ +T Sbjct: 496 LNSLRVEFHRPHSVGTSVENQPTQLDWDDLESYRCIIQELVKINLT 541 >At3g05060.1 68416.m00549 SAR DNA-binding protein, putative strong similarity to SAR DNA-binding protein-1 [Pisum sativum] GI:3132696; contains Pfam profile PF01798: Putative snoRNA binding domain Length = 533 Score = 27.9 bits (59), Expect = 5.7 Identities = 16/50 (32%), Positives = 28/50 (56%), Gaps = 2/50 (4%) Frame = +3 Query: 405 YKKAHEAIRADPSHKKKE--LKKDSVKQKRWEQTQAKLAERKNRIKQKKA 548 Y A +++ + S K +E KKD K+K+ E+ + + E + K+KKA Sbjct: 436 YNTAADSLLGETSAKSEEPSKKKDKKKKKKVEEEKPEEEEPSEKKKKKKA 485 >At3g27025.1 68416.m03381 expressed protein Length = 299 Score = 27.5 bits (58), Expect = 7.5 Identities = 20/48 (41%), Positives = 26/48 (54%), Gaps = 8/48 (16%) Frame = +3 Query: 351 QFSKYIKLGVTADAIEAIYKKAHEA---IRADP-----SHKKKELKKD 470 Q YI+ T DAI+ ++KK H A R D S KKK+LKK+ Sbjct: 183 QGEPYIEKHSTRDAIKRVFKKLHGASSKTRNDDEDDSMSKKKKDLKKN 230 >At1g56660.1 68414.m06516 expressed protein Length = 522 Score = 27.5 bits (58), Expect = 7.5 Identities = 21/79 (26%), Positives = 37/79 (46%), Gaps = 1/79 (1%) Frame = +3 Query: 318 LEQDDEDSFKRQFSKYIKLGVTADAIEAIYKKAHEAIRADPSHKKKEL-KKDSVKQKRWE 494 LE++ E K+ + + G +A +K HE + + ++E KK+ K+K Sbjct: 126 LEEEKEGKKKKNKKEKDESGPEEKNKKADKEKKHEDVSQEKEELEEEDGKKNKKKEKDES 185 Query: 495 QTQAKLAERKNRIKQKKAS 551 T+ K + K KQK+ S Sbjct: 186 GTEEKKKKPKKEKKQKEES 204 >At1g29000.1 68414.m03546 heavy-metal-associated domain-containing protein similar to farnesylated protein ATFP3 [GI:4097547]; contains Pfam profile PF00403: Heavy-metal-associated domain Length = 287 Score = 27.5 bits (58), Expect = 7.5 Identities = 16/56 (28%), Positives = 30/56 (53%), Gaps = 1/56 (1%) Frame = +3 Query: 381 TADAIEAIYKKAHEAIRADPSHKKKELKKDSV-KQKRWEQTQAKLAERKNRIKQKK 545 +A + I KK H+ S ++E KK+ K+K+ E+ + K + K + ++KK Sbjct: 160 SAKLLAYIKKKVHKHAEIISSKTEEEKKKEEEDKKKKEEEDKKKKEDEKKKEEEKK 215 >At1g09810.1 68414.m01101 expressed protein contains Pfam profile PF04146: YT521-B-like family Length = 428 Score = 27.5 bits (58), Expect = 7.5 Identities = 13/47 (27%), Positives = 25/47 (53%) Frame = +3 Query: 354 FSKYIKLGVTADAIEAIYKKAHEAIRADPSHKKKELKKDSVKQKRWE 494 F KY + D ++ Y++ +++RA HK L+ D K+K ++ Sbjct: 330 FKKYSAVTFLLDDMD-FYEEREKSLRAKKEHKPATLRMDLFKEKDYD 375 >At5g65390.1 68418.m08224 arabinogalactan-protein (AGP7) Length = 130 Score = 27.1 bits (57), Expect = 10.0 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = -1 Query: 197 PPSTAPFIAPKTRAPVVVRAKPTSK*HLNAPGPLS 93 PP+ P AP T P V PTS +AP P S Sbjct: 41 PPAATP--APTTTPPPAVSPAPTSSPPSSAPSPSS 73 >At5g49430.1 68418.m06116 transducin family protein / WD-40 repeat family protein similar to WD-repeat protein 9 (SP:Q9NSI6) {Homo sapiens}; contains Pfam PF00400: WD domain, G-beta repeat (4 copies) Length = 1677 Score = 27.1 bits (57), Expect = 10.0 Identities = 19/81 (23%), Positives = 37/81 (45%), Gaps = 3/81 (3%) Frame = +3 Query: 315 SLEQDD-EDSFKRQFSKYIK--LGVTADAIEAIYKKAHEAIRADPSHKKKELKKDSVKQK 485 S E DD ++S +R K K G+ + + K+ + + PS+KK+ K S +++ Sbjct: 821 SYEDDDHQNSLRRSKRKKHKKEAGIMTSSGRRVKKRNFDELEGAPSNKKRTRKSRSGRKE 880 Query: 486 RWEQTQAKLAERKNRIKQKKA 548 ++ + R R + A Sbjct: 881 SKRKSSKSKSSRPRRAAARNA 901 >At3g54570.1 68416.m06038 calmodulin-binding protein-related contains similarity to potato calmodulin-binding protein PCBP GI:17933110 from [Solanum tuberosum] Length = 417 Score = 27.1 bits (57), Expect = 10.0 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = -2 Query: 568 CSLLMKEAFFCLILFFLSANLACVCSQRFCLTESFFNSFF 449 CS L+K + F L F S ++ VC +C + +S F Sbjct: 124 CSSLLKNSKFTEDLMFTSPHILKVCPYTYCSLNAHLHSQF 163 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,838,784 Number of Sequences: 28952 Number of extensions: 232704 Number of successful extensions: 828 Number of sequences better than 10.0: 26 Number of HSP's better than 10.0 without gapping: 773 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 822 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1246162608 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -