BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30518 (757 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_0665 + 19688278-19688462,19688679-19688842,19688949-196891... 32 0.57 03_03_0214 + 15487367-15487388,15488220-15488375,15488690-154889... 30 1.7 03_06_0342 + 33268971-33270533 29 5.3 11_05_0087 + 18970741-18972702 28 9.2 >10_08_0665 + 19688278-19688462,19688679-19688842,19688949-19689112, 19689249-19689502,19690064-19690175 Length = 292 Score = 31.9 bits (69), Expect = 0.57 Identities = 29/100 (29%), Positives = 50/100 (50%), Gaps = 7/100 (7%) Frame = -1 Query: 382 NVVIYVWPMMRELAVLRREPILHQHQG-RHIRRMSLHLD-LQILPNVQCLVVDGFLVSIS 209 NVV++ +++++ L + ++H+HQG R + + LH + +L N+ LV+ G + Sbjct: 54 NVVVFAVAILQKMGALVWDKVVHEHQGWRLVTCIWLHAGVVHLLANMLSLVLIGLRLEQQ 113 Query: 208 AGVSVIK-LYI*SERSS---SKSFIRYK-GIGKGGFLFWL 104 G I +Y+ S S FIR +G G LF L Sbjct: 114 FGYMRIGIIYLVSGIGGSVLSSLFIRNSISVGASGALFGL 153 >03_03_0214 + 15487367-15487388,15488220-15488375,15488690-15488925, 15489013-15489132,15490466-15490480 Length = 182 Score = 30.3 bits (65), Expect = 1.7 Identities = 16/52 (30%), Positives = 27/52 (51%) Frame = +2 Query: 386 CLSPLKLEQPVK*TMTGYLKKL*INSKNLPRRRSSRRAQGKKEIQQATTKKS 541 C + + +++P LKK ++NL R RS G + +Q+TTKK+ Sbjct: 86 CAARVDVQEPNVSLTNASLKKKEFRTRNLKRNRSWTDKNGTRRKKQSTTKKT 137 >03_06_0342 + 33268971-33270533 Length = 520 Score = 28.7 bits (61), Expect = 5.3 Identities = 23/102 (22%), Positives = 50/102 (49%), Gaps = 1/102 (0%) Frame = -1 Query: 436 ASHSLLHWLFQFQRAETLNVVIYVWPMM-RELAVLRREPILHQHQGRHIRRMSLHLDLQI 260 +S SLL+ L L+++ +W ++ + L L+ + ++ +H RH RR++ +D + Sbjct: 6 SSSSLLNGL---NSGVVLSLIAVLWTVVWQNLQRLQLQTLVGRHMNRHARRLAALVDPYL 62 Query: 259 LPNVQCLVVDGFLVSISAGVSVIKLYI*SERSSSKSFIRYKG 134 +V +G + SA +K Y+ + + +R +G Sbjct: 63 --SVTIHEYEGGRMKRSAAYEEVKAYLSASSARDVRHLRAEG 102 >11_05_0087 + 18970741-18972702 Length = 653 Score = 27.9 bits (59), Expect = 9.2 Identities = 16/45 (35%), Positives = 25/45 (55%) Frame = -1 Query: 355 MRELAVLRREPILHQHQGRHIRRMSLHLDLQILPNVQCLVVDGFL 221 +R+ V L G H+RR+++H++ + LP VQ L D FL Sbjct: 156 LRDAFVRSAHAALAAAAGGHVRRLTMHVETERLP-VQ-LTADAFL 198 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,039,232 Number of Sequences: 37544 Number of extensions: 362834 Number of successful extensions: 880 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 861 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 880 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2016060588 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -