BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30513 (551 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 7.2 AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory recept... 21 7.2 U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 21 9.5 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.0 bits (42), Expect = 7.2 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = +2 Query: 503 SSSNARRPHDGW 538 SSS +PHD W Sbjct: 2362 SSSMTLKPHDSW 2373 >AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory receptor candidate 57 protein. Length = 387 Score = 21.0 bits (42), Expect = 7.2 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = -3 Query: 258 KSFFFSVCSFTIFRFNFSEF 199 K F+ CS FR NF+ F Sbjct: 101 KQEIFNCCSKKSFRMNFAIF 120 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 20.6 bits (41), Expect = 9.5 Identities = 10/31 (32%), Positives = 14/31 (45%) Frame = +1 Query: 166 KHMNLILGDCEEFRKIKSKNSKTADREEKRL 258 KH+ LG C +RK ++ S K L Sbjct: 533 KHVRAFLGLCNFYRKFCARYSAATQDLNKLL 563 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 102,930 Number of Sequences: 336 Number of extensions: 1659 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13621010 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -