BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30511 (724 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AM177180-1|CAJ45484.1| 1670|Homo sapiens kinesin-like protein KI... 32 1.8 AB007918-1|BAA32294.2| 1628|Homo sapiens KIAA0449 protein protein. 32 1.8 >AM177180-1|CAJ45484.1| 1670|Homo sapiens kinesin-like protein KIF21B variant protein. Length = 1670 Score = 32.3 bits (70), Expect = 1.8 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = +3 Query: 543 YSSPL*AGKTLLSHFRRPSNSLRQKLCNSVPWVTPCMP 656 + SP+ A T H S+ R KL N VP +TPC+P Sbjct: 1588 HDSPINAICTNAKHIFTASSDCRVKLWNYVPGLTPCLP 1625 >AB007918-1|BAA32294.2| 1628|Homo sapiens KIAA0449 protein protein. Length = 1628 Score = 32.3 bits (70), Expect = 1.8 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = +3 Query: 543 YSSPL*AGKTLLSHFRRPSNSLRQKLCNSVPWVTPCMP 656 + SP+ A T H S+ R KL N VP +TPC+P Sbjct: 1577 HDSPINAICTNAKHIFTASSDCRVKLWNYVPGLTPCLP 1614 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 109,257,370 Number of Sequences: 237096 Number of extensions: 2353431 Number of successful extensions: 4351 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4180 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4349 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8511181328 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -