BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30510 (738 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 28 0.080 U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodops... 22 6.9 AF091732-1|AAD02869.2| 154|Apis mellifera long-wavelength rhodo... 22 6.9 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 21 9.1 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 21 9.1 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 28.3 bits (60), Expect = 0.080 Identities = 13/47 (27%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = +1 Query: 157 LKWALDFNQKNKQLSTELPSPPG-YSQSSNANYANHQKIRTQIYSSL 294 ++W D + + ST P Y +N +Y +HQ +RT + +L Sbjct: 91 MRWPGDATGLSNRSSTSSNDPKNQYKNQNNNHYTSHQHLRTHLRGTL 137 >U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodopsin protein. Length = 377 Score = 21.8 bits (44), Expect = 6.9 Identities = 10/28 (35%), Positives = 11/28 (39%) Frame = +2 Query: 398 GWHVNSEAGEGAVCYTKYFQNG*RYTSY 481 GW+ G C T YF G SY Sbjct: 189 GWNRYVPEGNMTACGTDYFNRGLLSASY 216 >AF091732-1|AAD02869.2| 154|Apis mellifera long-wavelength rhodopsin protein. Length = 154 Score = 21.8 bits (44), Expect = 6.9 Identities = 10/28 (35%), Positives = 11/28 (39%) Frame = +2 Query: 398 GWHVNSEAGEGAVCYTKYFQNG*RYTSY 481 GW+ G C T YF G SY Sbjct: 65 GWNRYVPEGNMTACGTDYFNRGLLSASY 92 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.4 bits (43), Expect = 9.1 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = -2 Query: 212 GSSVESCLFF 183 GSS+ SCLFF Sbjct: 372 GSSIWSCLFF 381 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.4 bits (43), Expect = 9.1 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = -2 Query: 212 GSSVESCLFF 183 GSS+ SCLFF Sbjct: 425 GSSIWSCLFF 434 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 224,349 Number of Sequences: 438 Number of extensions: 5614 Number of successful extensions: 10 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23023035 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -