BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30507 (720 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 5.1 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 5.1 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 22 6.7 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 22 6.7 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 22.2 bits (45), Expect = 5.1 Identities = 9/42 (21%), Positives = 21/42 (50%) Frame = +1 Query: 115 QLWMGSLEPNMTESFIMAAFNRLGQRPLAVKVMRNKFTGEPA 240 +L + L P + ++ A+N++G PL+ ++ P+ Sbjct: 1071 ELRLTGLRPYTKYTLVVQAYNQVGSGPLSEPLLTQTMEDVPS 1112 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 22.2 bits (45), Expect = 5.1 Identities = 9/42 (21%), Positives = 21/42 (50%) Frame = +1 Query: 115 QLWMGSLEPNMTESFIMAAFNRLGQRPLAVKVMRNKFTGEPA 240 +L + L P + ++ A+N++G PL+ ++ P+ Sbjct: 1067 ELRLTGLRPYTKYTLVVQAYNQVGSGPLSEPLLTQTMEDVPS 1108 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 21.8 bits (44), Expect = 6.7 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +3 Query: 588 VLWTPDKNLSKICTAVPKPKK 650 +L+ PDKN+ + T K KK Sbjct: 763 ILFQPDKNIRRKVTMGDKSKK 783 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 21.8 bits (44), Expect = 6.7 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +3 Query: 588 VLWTPDKNLSKICTAVPKPKK 650 +L+ PDKN+ + T K KK Sbjct: 853 ILFQPDKNIRRKVTMGDKSKK 873 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 211,484 Number of Sequences: 438 Number of extensions: 4214 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22292145 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -