BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30506 (597 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory recept... 22 3.4 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 7.9 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 7.9 >AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory receptor candidate 15 protein. Length = 455 Score = 22.2 bits (45), Expect = 3.4 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = -3 Query: 532 NGHESDSQWVVANLLDV 482 N H S Q VV NLLD+ Sbjct: 58 NAHLSGIQLVVRNLLDI 74 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.0 bits (42), Expect = 7.9 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -3 Query: 496 NLLDV*GYFLLDFLKSGLTVWWFSGIHFVYSYDE 395 N L V FLL K L + W G+ +YDE Sbjct: 1276 NALFVLIVFLLTLKKDYLHIKWPFGVKTNITYDE 1309 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.0 bits (42), Expect = 7.9 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -3 Query: 496 NLLDV*GYFLLDFLKSGLTVWWFSGIHFVYSYDE 395 N L V FLL K L + W G+ +YDE Sbjct: 1276 NALFVLIVFLLTLKKDYLHIKWPFGVKTNITYDE 1309 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 153,058 Number of Sequences: 336 Number of extensions: 3495 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15039504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -