BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30504 (662 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292377-1|CAL23189.2| 358|Tribolium castaneum gustatory recept... 21 6.8 AM292341-1|CAL23153.2| 393|Tribolium castaneum gustatory recept... 21 6.8 >AM292377-1|CAL23189.2| 358|Tribolium castaneum gustatory receptor candidate 56 protein. Length = 358 Score = 21.4 bits (43), Expect = 6.8 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = +1 Query: 349 VTPEECDEISQKTLK 393 +T E C+E+S+K K Sbjct: 344 ITSETCEEVSKKCYK 358 >AM292341-1|CAL23153.2| 393|Tribolium castaneum gustatory receptor candidate 20 protein. Length = 393 Score = 21.4 bits (43), Expect = 6.8 Identities = 9/31 (29%), Positives = 17/31 (54%), Gaps = 2/31 (6%) Frame = -1 Query: 473 PIPVS--LVFINELYFCKFILINAISFSRFN 387 P+ VS L+F+ ++ FC F+ + + N Sbjct: 175 PVYVSYLLIFVQQIPFCFFVRVIRLKIEDLN 205 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 152,385 Number of Sequences: 336 Number of extensions: 3123 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17177325 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -