BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30504 (662 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF071163-1|AAC79999.1| 218|Anopheles gambiae glutathione S-tran... 25 2.8 AF071160-4|AAC79992.1| 218|Anopheles gambiae glutathione S-tran... 25 2.8 AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylch... 23 6.5 >AF071163-1|AAC79999.1| 218|Anopheles gambiae glutathione S-transferase D1-3 protein. Length = 218 Score = 24.6 bits (51), Expect = 2.8 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = -2 Query: 301 WQH*EPQLDPVHEFLRCDFSTAERVYVND*REQIIQRQIAFF 176 W+ Q+ V ++ D + AER+Y D R + + Q FF Sbjct: 64 WESRAIQIYLVEKYCAHDPALAERLYPGDPRRRAVVHQRLFF 105 >AF071160-4|AAC79992.1| 218|Anopheles gambiae glutathione S-transferase protein. Length = 218 Score = 24.6 bits (51), Expect = 2.8 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = -2 Query: 301 WQH*EPQLDPVHEFLRCDFSTAERVYVND*REQIIQRQIAFF 176 W+ Q+ V ++ D + AER+Y D R + + Q FF Sbjct: 64 WESRAIQIYLVEKYCAHDPALAERLYPGDPRRRAVVHQRLFF 105 >AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylcholine receptor subunitbeta 1 protein. Length = 519 Score = 23.4 bits (48), Expect = 6.5 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = +3 Query: 474 ARIPRPVTAASRDLVDTDRPELTDLRHRNEGIKDLLRSG 590 A IP+ ++A + EL+DL H N + L SG Sbjct: 380 AEIPKHISALGAKQSKMEVMELSDLHHPNCKMNRKLNSG 418 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 670,757 Number of Sequences: 2352 Number of extensions: 12482 Number of successful extensions: 19 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 66068490 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -