BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30504 (662 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 23 2.6 EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 21 7.9 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 23.0 bits (47), Expect = 2.6 Identities = 16/59 (27%), Positives = 30/59 (50%) Frame = +2 Query: 62 RAQLELLASLEKQVLQNLGASRDSTSVLQQMSTLIKSRKERNLPLDNLLALIIHIYSLG 238 ++Q + S ++Q Q + ++ S+LQ + +S ++ LP LLA I + S G Sbjct: 973 QSQQQSQQSQQQQQQQTIVTNQAGKSILQTANIKQQSPQQHVLPGKTLLASQIKLVSPG 1031 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 21.4 bits (43), Expect = 7.9 Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 4/40 (10%) Frame = +2 Query: 32 AVVQTLKSPRRAQLELLASLEK----QVLQNLGASRDSTS 139 A Q L + ++ ++LL + + Q LQNLGAS D S Sbjct: 24 AADQDLLNKQQDVIQLLQKISQPIPNQELQNLGASYDIES 63 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 178,394 Number of Sequences: 438 Number of extensions: 3266 Number of successful extensions: 11 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19977660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -