BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30502 (532 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 30 0.013 DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 21 5.9 DQ435329-1|ABD92644.1| 150|Apis mellifera OBP12 protein. 21 7.9 DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex det... 21 7.9 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 21 7.9 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 30.3 bits (65), Expect = 0.013 Identities = 20/53 (37%), Positives = 25/53 (47%), Gaps = 1/53 (1%) Frame = +1 Query: 349 LDLSHNNITKLNHELDRLTEVVTLDLSTNGIQNL-NKFLHSAQKLVHLNLANN 504 LDLS N +T + L L + TLDL N I N N + +L L L N Sbjct: 436 LDLSGNELTSVPDALRDLALLKTLDLGENRISNFYNGSFRNLDQLTGLRLIGN 488 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 21.4 bits (43), Expect = 5.9 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +3 Query: 318 PPPKAP*H*YFRSFPQ 365 PPP H Y R FP+ Sbjct: 322 PPPNLDYHDYSRQFPR 337 >DQ435329-1|ABD92644.1| 150|Apis mellifera OBP12 protein. Length = 150 Score = 21.0 bits (42), Expect = 7.9 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 532 KCDMASSFPCCLL 494 +CD+A SF C+L Sbjct: 131 ECDVALSFKLCML 143 >DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 7.9 Identities = 8/27 (29%), Positives = 17/27 (62%) Frame = +1 Query: 331 HHNINILDLSHNNITKLNHELDRLTEV 411 H+N N + ++NN KL + ++ + +V Sbjct: 91 HNNNNYNNNNYNNYKKLYYNINYIEQV 117 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 21.0 bits (42), Expect = 7.9 Identities = 6/15 (40%), Positives = 10/15 (66%) Frame = +2 Query: 143 LLGADMMTWTPVFSC 187 +LG ++ W P F+C Sbjct: 624 VLGVFLICWLPFFTC 638 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 143,532 Number of Sequences: 438 Number of extensions: 2736 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14968302 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -