BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30501 (501 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_4350| Best HMM Match : L15 (HMM E-Value=3.9e-10) 72 2e-13 SB_3035| Best HMM Match : PAN (HMM E-Value=2.9e-08) 32 0.31 SB_53807| Best HMM Match : MCM (HMM E-Value=0) 29 2.2 SB_22488| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_26471| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 >SB_4350| Best HMM Match : L15 (HMM E-Value=3.9e-10) Length = 173 Score = 72.1 bits (169), Expect = 2e-13 Identities = 38/77 (49%), Positives = 43/77 (55%) Frame = +3 Query: 249 SFNLDKLWTLVSEQTRLKYASAPDGKVPVINIVKAXXXXXXXXXXXPKQPVIVXXXXXXX 428 S NLDK+W+LVSEQTR Y + DG VPVI++VKA PKQPVIV Sbjct: 97 SINLDKVWSLVSEQTRQNYKNKKDGPVPVIDVVKAGYYKVLGKGLLPKQPVIVKAKFFSR 156 Query: 429 XXXXXXXDVGGACVLSA 479 VGGACVL A Sbjct: 157 RAEDKIKAVGGACVLMA 173 Score = 38.3 bits (85), Expect = 0.004 Identities = 14/25 (56%), Positives = 19/25 (76%) Frame = +1 Query: 160 RINMDKYHPGYFGKLGMRNFHFRKN 234 R + + HPGYFGK+GMR+FH +N Sbjct: 67 RGSYEAIHPGYFGKVGMRHFHLTRN 91 >SB_3035| Best HMM Match : PAN (HMM E-Value=2.9e-08) Length = 240 Score = 31.9 bits (69), Expect = 0.31 Identities = 17/46 (36%), Positives = 23/46 (50%) Frame = -3 Query: 244 RNSCSF*SGNFSYQVCQSIQDGTCPC*FCDGAHHQHYHDLLDAYGA 107 R+SC + F +C+S T PC D H +H DL+D GA Sbjct: 52 RSSCQ--ARCFMNNLCRSYNYNTTPCQLSDSDHLEHPSDLVDKPGA 95 >SB_53807| Best HMM Match : MCM (HMM E-Value=0) Length = 789 Score = 29.1 bits (62), Expect = 2.2 Identities = 16/43 (37%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = -3 Query: 295 LVCSETNVQ-SLSKLKLDRNSCSF*SGNFSYQVCQSIQDGTCP 170 +V S T + LS +K D CSF G F Q ++ G+CP Sbjct: 233 VVTSSTGIMPQLSVIKYDCPKCSFILGPFFQGSDQEVKPGSCP 275 >SB_22488| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 354 Score = 27.5 bits (58), Expect = 6.6 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = -3 Query: 499 ILLLIIYADSTQAPPTSLIFFSADFEKNF 413 I L+ YA+S P FFSADF+K F Sbjct: 291 ICLMFTYANSV-CNPVIYAFFSADFKKGF 318 >SB_26471| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 566 Score = 27.1 bits (57), Expect = 8.7 Identities = 6/14 (42%), Positives = 12/14 (85%) Frame = +3 Query: 168 HGQVPSWILWQTWY 209 +G+ SW++W+TW+ Sbjct: 342 YGEFSSWLVWRTWF 355 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,509,323 Number of Sequences: 59808 Number of extensions: 283231 Number of successful extensions: 663 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 526 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 662 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1087245449 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -