BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30499 (719 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_20823| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 36 0.025 SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) 36 0.033 SB_58039| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_1405| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.058 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.058 SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.058 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.076 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.076 SB_32426| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.076 SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.076 SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.076 SB_42354| Best HMM Match : GETHR (HMM E-Value=5.3) 35 0.076 SB_39747| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.076 SB_31452| Best HMM Match : Telo_bind (HMM E-Value=3.2) 35 0.076 SB_24720| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.076 SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.10 SB_50750| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.10 SB_39409| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.10 SB_30384| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.10 SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.10 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_22126| Best HMM Match : Glyco_transf_10 (HMM E-Value=1.9) 34 0.13 SB_21560| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_56749| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_52737| Best HMM Match : B_lectin (HMM E-Value=7.6) 34 0.13 SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_44042| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_37880| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_36241| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_27240| Best HMM Match : DUF765 (HMM E-Value=9.1) 34 0.13 SB_25775| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_17580| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_14354| Best HMM Match : TEP1_N (HMM E-Value=4.1) 34 0.13 SB_13217| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_9638| Best HMM Match : WD40 (HMM E-Value=8.4e-09) 34 0.13 SB_9213| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_3518| Best HMM Match : Ank (HMM E-Value=0.15) 34 0.13 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) 33 0.18 SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_44533| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_33267| Best HMM Match : F5_F8_type_C (HMM E-Value=3.4e-10) 33 0.18 SB_19807| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_9177| Best HMM Match : PPI_Ypi1 (HMM E-Value=1.9) 33 0.18 SB_2166| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 33 0.23 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_44658| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_30823| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_23894| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_17505| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_13520| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_2294| Best HMM Match : Extensin_2 (HMM E-Value=1.5) 33 0.23 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.31 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.31 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.31 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.31 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.31 SB_29332| Best HMM Match : PAN (HMM E-Value=0.039) 33 0.31 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 33 0.31 SB_53848| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.31 SB_51199| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.31 SB_46138| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.31 SB_36119| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.31 SB_31140| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.31 SB_26645| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.31 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.31 SB_15848| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.31 SB_9010| Best HMM Match : RVP (HMM E-Value=0.14) 33 0.31 SB_8768| Best HMM Match : TrmB (HMM E-Value=0.86) 33 0.31 SB_7956| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.31 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 32 0.41 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 32 0.41 SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_22074| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_14827| Best HMM Match : Neur_chan_LBD (HMM E-Value=3.8) 32 0.41 SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_50382| Best HMM Match : RVT_1 (HMM E-Value=0.026) 32 0.41 SB_49082| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_48102| Best HMM Match : Ribosomal_S17 (HMM E-Value=4.2e-34) 32 0.41 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_41271| Best HMM Match : EGF (HMM E-Value=1.2e-20) 32 0.41 SB_40640| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) 32 0.41 SB_35366| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_30964| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_30748| Best HMM Match : RBM1CTR (HMM E-Value=2.1) 32 0.41 SB_27903| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_23309| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_21334| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_19713| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_18165| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_12393| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_5609| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_5183| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_58229| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 32 0.54 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 32 0.54 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 32 0.54 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_55981| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_55207| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 32 0.54 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 32 0.54 SB_53988| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 32 0.54 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 32 0.54 SB_51855| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_51214| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 32 0.54 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_50043| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 32 0.54 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_48300| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_46947| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 32 0.54 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 32 0.54 SB_45923| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 32 0.54 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 32 0.54 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 32 0.54 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 32 0.54 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_39311| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) 32 0.54 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) 32 0.54 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 32 0.54 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 32 0.54 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 32 0.54 SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2) 32 0.54 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_36358| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_36096| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_35856| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_35635| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_35237| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_35223| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_35140| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_35136| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_35057| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_34738| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_34666| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_34487| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_34462| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_34192| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_34054| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_33950| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15) 32 0.54 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_33625| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_33515| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_33369| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_33216| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_33186| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_32571| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_32440| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_32437| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_32310| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_32140| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_31831| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_31632| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_31490| Best HMM Match : Aa_trans (HMM E-Value=4.9e-31) 32 0.54 SB_31476| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 32 0.54 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_31314| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_31291| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_31276| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_31029| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_30905| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_30578| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_30576| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_30418| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_30415| Best HMM Match : M (HMM E-Value=6.5e-05) 32 0.54 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_30025| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_29871| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_29445| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_29341| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) 32 0.54 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_29039| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_29037| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_28940| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 32 0.54 SB_28646| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_28530| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_28283| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_28216| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_28148| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 32 0.54 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_27823| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_27762| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_27362| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_26735| Best HMM Match : rve (HMM E-Value=0.00066) 32 0.54 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_26380| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_26309| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_25523| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_25409| Best HMM Match : PSD1 (HMM E-Value=7.2) 32 0.54 SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_24903| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_24636| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_24484| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_23912| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_23614| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_23287| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) 32 0.54 SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_22432| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_22377| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_22217| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_21996| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_21918| Best HMM Match : STT3 (HMM E-Value=0) 32 0.54 SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) 32 0.54 SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_20931| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_20759| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_20660| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_20556| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_20437| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_20335| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_20328| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 32 0.54 SB_20039| Best HMM Match : LRR_1 (HMM E-Value=0.0061) 32 0.54 SB_19740| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_19737| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_19598| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) 32 0.54 SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_17561| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_17455| Best HMM Match : Ank (HMM E-Value=2.2) 32 0.54 SB_17363| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_17297| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_17013| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_16390| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18) 32 0.54 SB_16122| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_15853| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_15736| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_15700| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_15584| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_15454| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_15441| Best HMM Match : RVT_1 (HMM E-Value=1e-19) 32 0.54 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_14523| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_14253| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_14086| Best HMM Match : POR (HMM E-Value=7.7) 32 0.54 SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_13737| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_13728| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_13672| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_13641| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_13401| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_13399| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) 32 0.54 SB_13203| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_13197| Best HMM Match : DUF765 (HMM E-Value=5.8) 32 0.54 SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_13059| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_12959| Best HMM Match : Peptidase_M16_C (HMM E-Value=1e-14) 32 0.54 SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) 32 0.54 SB_12508| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_12310| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_12176| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_11959| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_11796| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_11690| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_10906| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_10507| Best HMM Match : 7tm_1 (HMM E-Value=7.9e-09) 32 0.54 SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_10425| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_9919| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) 32 0.54 SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) 32 0.54 SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_8043| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_7837| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_7679| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_7446| Best HMM Match : SH2 (HMM E-Value=2.7e-22) 32 0.54 SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_7304| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_7279| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_7158| Best HMM Match : Copper-fist (HMM E-Value=7.1) 32 0.54 SB_7027| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_6958| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_6846| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_6413| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_6345| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_5250| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 >SB_20823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 227 Score = 36.3 bits (80), Expect = 0.025 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = -2 Query: 73 VSFERN*LSRPGDPLVLERPPP 8 VSF R+ PGDPLVLERPPP Sbjct: 4 VSFARSNSCSPGDPLVLERPPP 25 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 36.3 bits (80), Expect = 0.025 Identities = 17/37 (45%), Positives = 22/37 (59%) Frame = +1 Query: 10 VAAALELVDPPACLINSFQMKRSCHAPFTSSLFLLCS 120 VAAALELVDPP C + QM + + F ++CS Sbjct: 96 VAAALELVDPPGCRNSIQQMVHTAMSAFPGKSIIMCS 132 >SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) Length = 176 Score = 35.9 bits (79), Expect = 0.033 Identities = 21/38 (55%), Positives = 24/38 (63%) Frame = -2 Query: 121 GNKVKIMTK*TEHGSSVSFERN*LSRPGDPLVLERPPP 8 G VKI+ T G ++F N S PGDPLVLERPPP Sbjct: 34 GLPVKILASKTA-GDVIAFISNSCS-PGDPLVLERPPP 69 >SB_58039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 35.5 bits (78), Expect = 0.044 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = -2 Query: 70 SFERN*LSRPGDPLVLERPPP 8 S E++ RPGDPLVLERPPP Sbjct: 23 SMEQSNSCRPGDPLVLERPPP 43 >SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 35.5 bits (78), Expect = 0.044 Identities = 19/39 (48%), Positives = 24/39 (61%) Frame = -2 Query: 124 RGNKVKIMTK*TEHGSSVSFERN*LSRPGDPLVLERPPP 8 +GNK+ + + S+S N S PGDPLVLERPPP Sbjct: 14 KGNKMLVPGPPSRSTVSISLISNSCS-PGDPLVLERPPP 51 >SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 35.5 bits (78), Expect = 0.044 Identities = 19/39 (48%), Positives = 24/39 (61%) Frame = -2 Query: 124 RGNKVKIMTK*TEHGSSVSFERN*LSRPGDPLVLERPPP 8 +GNK+ + + S+S N S PGDPLVLERPPP Sbjct: 12 KGNKMLVPGPPSRSTVSISLISNSCS-PGDPLVLERPPP 49 >SB_1405| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 35.5 bits (78), Expect = 0.044 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -2 Query: 67 FERN*LSRPGDPLVLERPPP 8 FER+ PGDPLVLERPPP Sbjct: 19 FERSNSCSPGDPLVLERPPP 38 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 35.1 bits (77), Expect = 0.058 Identities = 19/39 (48%), Positives = 23/39 (58%) Frame = -2 Query: 124 RGNKVKIMTK*TEHGSSVSFERN*LSRPGDPLVLERPPP 8 +GNK + + S+S N S PGDPLVLERPPP Sbjct: 14 KGNKTLVPGPPSRSTVSISLISNSCS-PGDPLVLERPPP 51 >SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 35.1 bits (77), Expect = 0.058 Identities = 19/39 (48%), Positives = 23/39 (58%) Frame = -2 Query: 124 RGNKVKIMTK*TEHGSSVSFERN*LSRPGDPLVLERPPP 8 +GNK + + S+S N S PGDPLVLERPPP Sbjct: 14 KGNKTLVPGPPSRSTVSISLISNSCS-PGDPLVLERPPP 51 >SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 35.1 bits (77), Expect = 0.058 Identities = 19/39 (48%), Positives = 23/39 (58%) Frame = -2 Query: 124 RGNKVKIMTK*TEHGSSVSFERN*LSRPGDPLVLERPPP 8 +GNK + + S+S N S PGDPLVLERPPP Sbjct: 14 KGNKTLVPGPPSRSTVSISLISNSCS-PGDPLVLERPPP 51 >SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 487 Score = 34.7 bits (76), Expect = 0.076 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 52 LSRPGDPLVLERPPP 8 LS PGDPLVLERPPP Sbjct: 366 LSSPGDPLVLERPPP 380 >SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 34.7 bits (76), Expect = 0.076 Identities = 15/22 (68%), Positives = 16/22 (72%) Frame = -2 Query: 73 VSFERN*LSRPGDPLVLERPPP 8 V ER+ PGDPLVLERPPP Sbjct: 8 VKLERSNSCSPGDPLVLERPPP 29 >SB_32426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 779 Score = 34.7 bits (76), Expect = 0.076 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 52 LSRPGDPLVLERPPP 8 LS PGDPLVLERPPP Sbjct: 431 LSSPGDPLVLERPPP 445 >SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 34.7 bits (76), Expect = 0.076 Identities = 16/23 (69%), Positives = 19/23 (82%) Frame = -2 Query: 76 SVSFERN*LSRPGDPLVLERPPP 8 S+S++ N S PGDPLVLERPPP Sbjct: 7 SLSYQSNSCS-PGDPLVLERPPP 28 >SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 34.7 bits (76), Expect = 0.076 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = -2 Query: 70 SFERN*LSRPGDPLVLERPPP 8 ++ER+ PGDPLVLERPPP Sbjct: 5 AYERSNSCSPGDPLVLERPPP 25 >SB_42354| Best HMM Match : GETHR (HMM E-Value=5.3) Length = 162 Score = 34.7 bits (76), Expect = 0.076 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -2 Query: 61 RN*LSRPGDPLVLERPPP 8 R+ +RPGDPLVLERPPP Sbjct: 38 RHSTTRPGDPLVLERPPP 55 >SB_39747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 356 Score = 34.7 bits (76), Expect = 0.076 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = -2 Query: 67 FERN*LSRPGDPLVLERPPP 8 F+ +RPGDPLVLERPPP Sbjct: 230 FQPKYCARPGDPLVLERPPP 249 >SB_31452| Best HMM Match : Telo_bind (HMM E-Value=3.2) Length = 200 Score = 34.7 bits (76), Expect = 0.076 Identities = 13/15 (86%), Positives = 15/15 (100%) Frame = -2 Query: 52 LSRPGDPLVLERPPP 8 ++RPGDPLVLERPPP Sbjct: 80 VTRPGDPLVLERPPP 94 >SB_24720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 34.7 bits (76), Expect = 0.076 Identities = 16/24 (66%), Positives = 17/24 (70%) Frame = -2 Query: 79 SSVSFERN*LSRPGDPLVLERPPP 8 SS ER+ PGDPLVLERPPP Sbjct: 1 SSARNERSNSCSPGDPLVLERPPP 24 >SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 682 Score = 34.3 bits (75), Expect = 0.10 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = -2 Query: 88 EHGSSVSFERN*LSRPGDPLVLERPPP 8 EH +S N S PGDPLVLERPPP Sbjct: 550 EHSKILSDRSNSCS-PGDPLVLERPPP 575 >SB_50750| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 34.3 bits (75), Expect = 0.10 Identities = 17/23 (73%), Positives = 17/23 (73%) Frame = -2 Query: 76 SVSFERN*LSRPGDPLVLERPPP 8 S SF N S PGDPLVLERPPP Sbjct: 16 SYSFRSNSCS-PGDPLVLERPPP 37 >SB_39409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 34.3 bits (75), Expect = 0.10 Identities = 16/29 (55%), Positives = 20/29 (68%), Gaps = 2/29 (6%) Frame = -2 Query: 88 EHGSSV--SFERN*LSRPGDPLVLERPPP 8 E+G + +FE + PGDPLVLERPPP Sbjct: 50 EYGGEILAAFELSNSCSPGDPLVLERPPP 78 >SB_30384| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 208 Score = 34.3 bits (75), Expect = 0.10 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -2 Query: 49 SRPGDPLVLERPPP 8 +RPGDPLVLERPPP Sbjct: 88 NRPGDPLVLERPPP 101 >SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 34.3 bits (75), Expect = 0.10 Identities = 19/39 (48%), Positives = 23/39 (58%) Frame = -2 Query: 124 RGNKVKIMTK*TEHGSSVSFERN*LSRPGDPLVLERPPP 8 +GNK + + S+S N S PGDPLVLERPPP Sbjct: 14 KGNKSLVPGPPSRSTVSISLISNSCS-PGDPLVLERPPP 51 >SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 33.9 bits (74), Expect = 0.13 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 46 RPGDPLVLERPPP 8 RPGDPLVLERPPP Sbjct: 26 RPGDPLVLERPPP 38 >SB_22126| Best HMM Match : Glyco_transf_10 (HMM E-Value=1.9) Length = 460 Score = 33.9 bits (74), Expect = 0.13 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 46 RPGDPLVLERPPP 8 RPGDPLVLERPPP Sbjct: 341 RPGDPLVLERPPP 353 >SB_21560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 33.9 bits (74), Expect = 0.13 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 46 RPGDPLVLERPPP 8 RPGDPLVLERPPP Sbjct: 26 RPGDPLVLERPPP 38 >SB_56749| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 33.9 bits (74), Expect = 0.13 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 46 RPGDPLVLERPPP 8 RPGDPLVLERPPP Sbjct: 36 RPGDPLVLERPPP 48 >SB_52737| Best HMM Match : B_lectin (HMM E-Value=7.6) Length = 187 Score = 33.9 bits (74), Expect = 0.13 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 52 LSRPGDPLVLERPPP 8 L+ PGDPLVLERPPP Sbjct: 67 LANPGDPLVLERPPP 81 >SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/23 (69%), Positives = 18/23 (78%) Frame = -2 Query: 76 SVSFERN*LSRPGDPLVLERPPP 8 S++F N S PGDPLVLERPPP Sbjct: 15 SIAFVSNSCS-PGDPLVLERPPP 36 >SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.9 bits (74), Expect = 0.13 Identities = 15/27 (55%), Positives = 18/27 (66%) Frame = -2 Query: 88 EHGSSVSFERN*LSRPGDPLVLERPPP 8 EH + S+ + PGDPLVLERPPP Sbjct: 23 EHVTICSYRISNSCSPGDPLVLERPPP 49 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 33.9 bits (74), Expect = 0.13 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = -2 Query: 82 GSSVSFERN*LSRPGDPLVLERPPP 8 GSS + N S PGDPLVLERPPP Sbjct: 2416 GSSSAIASNSCS-PGDPLVLERPPP 2439 >SB_44042| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 33.9 bits (74), Expect = 0.13 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 46 RPGDPLVLERPPP 8 RPGDPLVLERPPP Sbjct: 26 RPGDPLVLERPPP 38 >SB_37880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 33.9 bits (74), Expect = 0.13 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 46 RPGDPLVLERPPP 8 RPGDPLVLERPPP Sbjct: 195 RPGDPLVLERPPP 207 >SB_36241| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 33.9 bits (74), Expect = 0.13 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 46 RPGDPLVLERPPP 8 RPGDPLVLERPPP Sbjct: 26 RPGDPLVLERPPP 38 >SB_27240| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 137 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/24 (66%), Positives = 19/24 (79%) Frame = -2 Query: 79 SSVSFERN*LSRPGDPLVLERPPP 8 ++VS+ N S PGDPLVLERPPP Sbjct: 8 TNVSYTSNSCS-PGDPLVLERPPP 30 >SB_25775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 241 Score = 33.9 bits (74), Expect = 0.13 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 46 RPGDPLVLERPPP 8 RPGDPLVLERPPP Sbjct: 123 RPGDPLVLERPPP 135 >SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 33.9 bits (74), Expect = 0.13 Identities = 18/34 (52%), Positives = 21/34 (61%) Frame = -2 Query: 109 KIMTK*TEHGSSVSFERN*LSRPGDPLVLERPPP 8 K+M K S++ N S PGDPLVLERPPP Sbjct: 74 KLMRKLAVDASNLLLTSNSCS-PGDPLVLERPPP 106 >SB_17580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 33.9 bits (74), Expect = 0.13 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 46 RPGDPLVLERPPP 8 RPGDPLVLERPPP Sbjct: 26 RPGDPLVLERPPP 38 >SB_14354| Best HMM Match : TEP1_N (HMM E-Value=4.1) Length = 275 Score = 33.9 bits (74), Expect = 0.13 Identities = 17/35 (48%), Positives = 23/35 (65%) Frame = -2 Query: 112 VKIMTK*TEHGSSVSFERN*LSRPGDPLVLERPPP 8 V+++ + H ++V N S PGDPLVLERPPP Sbjct: 135 VRLLRTKSGHSAAVGGGSNSCS-PGDPLVLERPPP 168 >SB_13217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 33.9 bits (74), Expect = 0.13 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 46 RPGDPLVLERPPP 8 RPGDPLVLERPPP Sbjct: 23 RPGDPLVLERPPP 35 >SB_9638| Best HMM Match : WD40 (HMM E-Value=8.4e-09) Length = 781 Score = 33.9 bits (74), Expect = 0.13 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 52 LSRPGDPLVLERPPP 8 L+ PGDPLVLERPPP Sbjct: 661 LNHPGDPLVLERPPP 675 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 521 PGDPLVLERPPP 532 >SB_9213| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 33.9 bits (74), Expect = 0.13 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 46 RPGDPLVLERPPP 8 RPGDPLVLERPPP Sbjct: 26 RPGDPLVLERPPP 38 >SB_3518| Best HMM Match : Ank (HMM E-Value=0.15) Length = 159 Score = 33.9 bits (74), Expect = 0.13 Identities = 19/39 (48%), Positives = 25/39 (64%) Frame = -2 Query: 124 RGNKVKIMTK*TEHGSSVSFERN*LSRPGDPLVLERPPP 8 R N V+++ + G+SV+ S PGDPLVLERPPP Sbjct: 16 RENHVEVVRLLLDCGASVNAPFP-NSSPGDPLVLERPPP 53 >SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 33.5 bits (73), Expect = 0.18 Identities = 16/24 (66%), Positives = 18/24 (75%) Frame = -2 Query: 79 SSVSFERN*LSRPGDPLVLERPPP 8 ++ SF N S PGDPLVLERPPP Sbjct: 9 NNTSFTSNSCS-PGDPLVLERPPP 31 >SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) Length = 280 Score = 33.5 bits (73), Expect = 0.18 Identities = 16/23 (69%), Positives = 18/23 (78%) Frame = -2 Query: 76 SVSFERN*LSRPGDPLVLERPPP 8 +V+F N S PGDPLVLERPPP Sbjct: 152 AVAFPSNSCS-PGDPLVLERPPP 173 >SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 33.5 bits (73), Expect = 0.18 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 79 SSVSFERN*LSRPGDPLVLERPPP 8 +++ F N S PGDPLVLERPPP Sbjct: 11 ANIKFRSNSCS-PGDPLVLERPPP 33 >SB_44533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 33.5 bits (73), Expect = 0.18 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -2 Query: 70 SFERN*LSRPGDPLVLERPPP 8 S +R+ PGDPLVLERPPP Sbjct: 26 SLQRSNSCSPGDPLVLERPPP 46 >SB_33267| Best HMM Match : F5_F8_type_C (HMM E-Value=3.4e-10) Length = 1292 Score = 33.5 bits (73), Expect = 0.18 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 52 LSRPGDPLVLERPPP 8 L+ PGDPLVLERPPP Sbjct: 1172 LTSPGDPLVLERPPP 1186 >SB_19807| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 33.5 bits (73), Expect = 0.18 Identities = 14/19 (73%), Positives = 16/19 (84%) Frame = -2 Query: 64 ERN*LSRPGDPLVLERPPP 8 ER+ + PGDPLVLERPPP Sbjct: 25 ERSGYTCPGDPLVLERPPP 43 >SB_9177| Best HMM Match : PPI_Ypi1 (HMM E-Value=1.9) Length = 121 Score = 33.5 bits (73), Expect = 0.18 Identities = 18/35 (51%), Positives = 20/35 (57%) Frame = -2 Query: 112 VKIMTK*TEHGSSVSFERN*LSRPGDPLVLERPPP 8 + M K E S+ N S PGDPLVLERPPP Sbjct: 79 IDAMRKSIEPPSATGISSNSCS-PGDPLVLERPPP 112 >SB_2166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 33.5 bits (73), Expect = 0.18 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -2 Query: 67 FERN*LSRPGDPLVLERPPP 8 FE N S PGDPLVLERPPP Sbjct: 16 FESNSCS-PGDPLVLERPPP 34 >SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 33.1 bits (72), Expect = 0.23 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 52 LSRPGDPLVLERPPP 8 L PGDPLVLERPPP Sbjct: 46 LESPGDPLVLERPPP 60 >SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) Length = 496 Score = 33.1 bits (72), Expect = 0.23 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 52 LSRPGDPLVLERPPP 8 L PGDPLVLERPPP Sbjct: 45 LKSPGDPLVLERPPP 59 >SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 33.1 bits (72), Expect = 0.23 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = -2 Query: 91 TEHGSSVSFERN*LSRPGDPLVLERPPP 8 T H + + N S PGDPLVLERPPP Sbjct: 15 TGHAKNDALSSNSCS-PGDPLVLERPPP 41 >SB_44658| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 33.1 bits (72), Expect = 0.23 Identities = 17/28 (60%), Positives = 19/28 (67%), Gaps = 3/28 (10%) Frame = -2 Query: 82 GSSVSFERN*LSR---PGDPLVLERPPP 8 GS VS ++ S PGDPLVLERPPP Sbjct: 3 GSRVSIKQQATSNSCSPGDPLVLERPPP 30 >SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 33.1 bits (72), Expect = 0.23 Identities = 18/39 (46%), Positives = 23/39 (58%) Frame = -2 Query: 124 RGNKVKIMTK*TEHGSSVSFERN*LSRPGDPLVLERPPP 8 +GN+ + + S+S N S PGDPLVLERPPP Sbjct: 14 KGNRKLVPGPPSRSTVSISLISNSCS-PGDPLVLERPPP 51 >SB_30823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 33.1 bits (72), Expect = 0.23 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = -2 Query: 76 SVSFERN*LSRPGDPLVLERPPP 8 +V+ R+ PGDPLVLERPPP Sbjct: 55 TVTHRRSNSCSPGDPLVLERPPP 77 >SB_23894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 33.1 bits (72), Expect = 0.23 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = -2 Query: 88 EHGSSVSFERN*LSRPGDPLVLERPPP 8 + GSS ++R PGDPLVLERPPP Sbjct: 42 QKGSSRIYKRK---SPGDPLVLERPPP 65 >SB_17505| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 33.1 bits (72), Expect = 0.23 Identities = 16/26 (61%), Positives = 19/26 (73%) Frame = -2 Query: 85 HGSSVSFERN*LSRPGDPLVLERPPP 8 H + + +E N S PGDPLVLERPPP Sbjct: 13 HITDLYWESNSCS-PGDPLVLERPPP 37 >SB_13520| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 33.1 bits (72), Expect = 0.23 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = -2 Query: 64 ERN*LSRPGDPLVLERPPP 8 ER+ PGDPLVLERPPP Sbjct: 30 ERSNSCSPGDPLVLERPPP 48 >SB_2294| Best HMM Match : Extensin_2 (HMM E-Value=1.5) Length = 310 Score = 33.1 bits (72), Expect = 0.23 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 49 SRPGDPLVLERPPP 8 S PGDPLVLERPPP Sbjct: 191 SSPGDPLVLERPPP 204 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 32.7 bits (71), Expect = 0.31 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 79 SSVSFERN*LSRPGDPLVLERPPP 8 +++ F N S PGDPLVLERPPP Sbjct: 11 ANICFTSNSCS-PGDPLVLERPPP 33 >SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 302 Score = 32.7 bits (71), Expect = 0.31 Identities = 16/27 (59%), Positives = 18/27 (66%), Gaps = 1/27 (3%) Frame = -2 Query: 85 HGSSVSFERN*LS-RPGDPLVLERPPP 8 + +S N LS PGDPLVLERPPP Sbjct: 169 NAQGISAVTNQLSANPGDPLVLERPPP 195 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 32.7 bits (71), Expect = 0.31 Identities = 15/28 (53%), Positives = 19/28 (67%) Frame = -2 Query: 91 TEHGSSVSFERN*LSRPGDPLVLERPPP 8 T G+S+ + + PGDPLVLERPPP Sbjct: 6 TVAGASIVQQISNSCSPGDPLVLERPPP 33 >SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 32.7 bits (71), Expect = 0.31 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 79 SSVSFERN*LSRPGDPLVLERPPP 8 +++ F N S PGDPLVLERPPP Sbjct: 11 ANIFFRSNSCS-PGDPLVLERPPP 33 >SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 32.7 bits (71), Expect = 0.31 Identities = 16/23 (69%), Positives = 18/23 (78%) Frame = -2 Query: 76 SVSFERN*LSRPGDPLVLERPPP 8 SV+ + N S PGDPLVLERPPP Sbjct: 19 SVASQSNSCS-PGDPLVLERPPP 40 >SB_29332| Best HMM Match : PAN (HMM E-Value=0.039) Length = 340 Score = 32.7 bits (71), Expect = 0.31 Identities = 12/15 (80%), Positives = 14/15 (93%) Frame = -2 Query: 52 LSRPGDPLVLERPPP 8 ++ PGDPLVLERPPP Sbjct: 219 VANPGDPLVLERPPP 233 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 32.7 bits (71), Expect = 0.31 Identities = 18/32 (56%), Positives = 20/32 (62%) Frame = +1 Query: 10 VAAALELVDPPACLINSFQMKRSCHAPFTSSL 105 VAAALELVDPP C NS + CH F S+ Sbjct: 66 VAAALELVDPPGCR-NSITVFH-CHTKFRMSI 95 >SB_53848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 32.7 bits (71), Expect = 0.31 Identities = 16/22 (72%), Positives = 16/22 (72%) Frame = -2 Query: 73 VSFERN*LSRPGDPLVLERPPP 8 V F N S PGDPLVLERPPP Sbjct: 25 VKFTSNSCS-PGDPLVLERPPP 45 >SB_51199| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 32.7 bits (71), Expect = 0.31 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = -2 Query: 76 SVSFERN*LSRPGDPLVLERPPP 8 S+ + N PGDPLVLERPPP Sbjct: 20 SLRLKMNYAEIPGDPLVLERPPP 42 >SB_46138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1106 Score = 32.7 bits (71), Expect = 0.31 Identities = 12/15 (80%), Positives = 14/15 (93%) Frame = -2 Query: 52 LSRPGDPLVLERPPP 8 ++ PGDPLVLERPPP Sbjct: 321 IASPGDPLVLERPPP 335 >SB_36119| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 32.7 bits (71), Expect = 0.31 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = -2 Query: 91 TEHGSSVSFERN*LSRPGDPLVLERPPP 8 T S + +R+ PGDPLVLERPPP Sbjct: 14 TRGDSPIVEKRSNSCSPGDPLVLERPPP 41 >SB_31140| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 220 Score = 32.7 bits (71), Expect = 0.31 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = -2 Query: 61 RN*LSRPGDPLVLERPPP 8 RN PGDPLVLERPPP Sbjct: 96 RNDKITPGDPLVLERPPP 113 >SB_26645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 32.7 bits (71), Expect = 0.31 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 52 LSRPGDPLVLERPPP 8 L+ PGDPLVLERPPP Sbjct: 26 LACPGDPLVLERPPP 40 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 32.7 bits (71), Expect = 0.31 Identities = 19/34 (55%), Positives = 20/34 (58%) Frame = -2 Query: 109 KIMTK*TEHGSSVSFERN*LSRPGDPLVLERPPP 8 K TK E + E N S PGDPLVLERPPP Sbjct: 38 KNTTKDAEFFAENGSESNSCS-PGDPLVLERPPP 70 >SB_15848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 32.7 bits (71), Expect = 0.31 Identities = 18/26 (69%), Positives = 19/26 (73%) Frame = -2 Query: 85 HGSSVSFERN*LSRPGDPLVLERPPP 8 HGS+ F N S PGDPLVLERPPP Sbjct: 58 HGSN--FLSNSCS-PGDPLVLERPPP 80 >SB_9010| Best HMM Match : RVP (HMM E-Value=0.14) Length = 711 Score = 32.7 bits (71), Expect = 0.31 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = -2 Query: 91 TEHGSSVSFERN*LSRPGDPLVLERPPP 8 T ++ + L PGDPLVLERPPP Sbjct: 165 TPQNTATQMSQEALLCPGDPLVLERPPP 192 >SB_8768| Best HMM Match : TrmB (HMM E-Value=0.86) Length = 480 Score = 32.7 bits (71), Expect = 0.31 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = -2 Query: 58 N*LSRPGDPLVLERPPP 8 N + PGDPLVLERPPP Sbjct: 357 NIFTSPGDPLVLERPPP 373 >SB_7956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 32.7 bits (71), Expect = 0.31 Identities = 16/22 (72%), Positives = 16/22 (72%) Frame = -2 Query: 73 VSFERN*LSRPGDPLVLERPPP 8 V F N S PGDPLVLERPPP Sbjct: 5 VGFTSNSCS-PGDPLVLERPPP 25 >SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 32.3 bits (70), Expect = 0.41 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -2 Query: 52 LSRPGDPLVLERPPP 8 + PGDPLVLERPPP Sbjct: 50 IRNPGDPLVLERPPP 64 >SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2070 Score = 32.3 bits (70), Expect = 0.41 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = -2 Query: 73 VSFERN*LSRPGDPLVLERPPP 8 V+F N S PGDPLVLERPPP Sbjct: 512 VTFLSNSCS-PGDPLVLERPPP 532 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 32.3 bits (70), Expect = 0.41 Identities = 16/24 (66%), Positives = 18/24 (75%) Frame = -2 Query: 79 SSVSFERN*LSRPGDPLVLERPPP 8 ++V F N S PGDPLVLERPPP Sbjct: 5 NAVLFVSNSCS-PGDPLVLERPPP 27 >SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) Length = 143 Score = 32.3 bits (70), Expect = 0.41 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = -2 Query: 88 EHGSSVSFERN*LSRPGDPLVLERPPP 8 E G S N S PGDPLVLERPPP Sbjct: 11 EQGKYKSSTSNSCS-PGDPLVLERPPP 36 >SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) Length = 325 Score = 32.3 bits (70), Expect = 0.41 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = -2 Query: 76 SVSFERN*LSRPGDPLVLERPPP 8 S++ N PGDPLVLERPPP Sbjct: 149 SIAEPSNGHRNPGDPLVLERPPP 171 >SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 236 Score = 32.3 bits (70), Expect = 0.41 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -2 Query: 70 SFERN*LSRPGDPLVLERPPP 8 S E N S PGDPLVLERPPP Sbjct: 110 SVESNSCS-PGDPLVLERPPP 129 >SB_22074| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 572 Score = 32.3 bits (70), Expect = 0.41 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 49 SRPGDPLVLERPPP 8 + PGDPLVLERPPP Sbjct: 293 AHPGDPLVLERPPP 306 >SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 32.3 bits (70), Expect = 0.41 Identities = 14/22 (63%), Positives = 16/22 (72%) Frame = -2 Query: 73 VSFERN*LSRPGDPLVLERPPP 8 V F+ + PGDPLVLERPPP Sbjct: 30 VGFKVSNSCSPGDPLVLERPPP 51 >SB_14827| Best HMM Match : Neur_chan_LBD (HMM E-Value=3.8) Length = 156 Score = 32.3 bits (70), Expect = 0.41 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 49 SRPGDPLVLERPPP 8 + PGDPLVLERPPP Sbjct: 36 NNPGDPLVLERPPP 49 >SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 32.3 bits (70), Expect = 0.41 Identities = 14/27 (51%), Positives = 17/27 (62%) Frame = -2 Query: 88 EHGSSVSFERN*LSRPGDPLVLERPPP 8 EH + + + PGDPLVLERPPP Sbjct: 731 EHTRELEEDGSYSCSPGDPLVLERPPP 757 >SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 32.3 bits (70), Expect = 0.41 Identities = 13/22 (59%), Positives = 16/22 (72%) Frame = -2 Query: 73 VSFERN*LSRPGDPLVLERPPP 8 ++ R+ PGDPLVLERPPP Sbjct: 21 IAVRRSNSCSPGDPLVLERPPP 42 >SB_50382| Best HMM Match : RVT_1 (HMM E-Value=0.026) Length = 1036 Score = 32.3 bits (70), Expect = 0.41 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 52 LSRPGDPLVLERPPP 8 L PGDPLVLERPPP Sbjct: 112 LHYPGDPLVLERPPP 126 >SB_49082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 32.3 bits (70), Expect = 0.41 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -2 Query: 67 FERN*LSRPGDPLVLERPPP 8 F+ N S PGDPLVLERPPP Sbjct: 16 FQSNSCS-PGDPLVLERPPP 34 >SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 32.3 bits (70), Expect = 0.41 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = -2 Query: 76 SVSFERN*LSRPGDPLVLERPPP 8 ++ R+ PGDPLVLERPPP Sbjct: 59 AIRLSRSNSCSPGDPLVLERPPP 81 >SB_48102| Best HMM Match : Ribosomal_S17 (HMM E-Value=4.2e-34) Length = 208 Score = 32.3 bits (70), Expect = 0.41 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 49 SRPGDPLVLERPPP 8 + PGDPLVLERPPP Sbjct: 89 ANPGDPLVLERPPP 102 >SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 32.3 bits (70), Expect = 0.41 Identities = 16/23 (69%), Positives = 17/23 (73%) Frame = -2 Query: 76 SVSFERN*LSRPGDPLVLERPPP 8 S+S N S PGDPLVLERPPP Sbjct: 30 SISLISNSCS-PGDPLVLERPPP 51 >SB_41271| Best HMM Match : EGF (HMM E-Value=1.2e-20) Length = 169 Score = 32.3 bits (70), Expect = 0.41 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 49 SRPGDPLVLERPPP 8 S PGDPLVLERPPP Sbjct: 110 SCPGDPLVLERPPP 123 >SB_40640| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 209 Score = 32.3 bits (70), Expect = 0.41 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = -2 Query: 61 RN*LSRPGDPLVLERPPP 8 R+ PGDPLVLERPPP Sbjct: 85 RDSYENPGDPLVLERPPP 102 >SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) Length = 138 Score = 32.3 bits (70), Expect = 0.41 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -2 Query: 70 SFERN*LSRPGDPLVLERPPP 8 SF N S PGDPLVLERPPP Sbjct: 12 SFVSNSCS-PGDPLVLERPPP 31 >SB_35366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 32.3 bits (70), Expect = 0.41 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 52 LSRPGDPLVLERPPP 8 L PGDPLVLERPPP Sbjct: 27 LRGPGDPLVLERPPP 41 >SB_30964| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 279 Score = 32.3 bits (70), Expect = 0.41 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 52 LSRPGDPLVLERPPP 8 L PGDPLVLERPPP Sbjct: 158 LISPGDPLVLERPPP 172 >SB_30748| Best HMM Match : RBM1CTR (HMM E-Value=2.1) Length = 390 Score = 32.3 bits (70), Expect = 0.41 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -2 Query: 52 LSRPGDPLVLERPPP 8 + PGDPLVLERPPP Sbjct: 98 IDSPGDPLVLERPPP 112 >SB_27903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 32.3 bits (70), Expect = 0.41 Identities = 16/22 (72%), Positives = 16/22 (72%) Frame = -2 Query: 73 VSFERN*LSRPGDPLVLERPPP 8 VS N S PGDPLVLERPPP Sbjct: 4 VSLSSNSCS-PGDPLVLERPPP 24 >SB_23309| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 32.3 bits (70), Expect = 0.41 Identities = 15/27 (55%), Positives = 18/27 (66%) Frame = -2 Query: 88 EHGSSVSFERN*LSRPGDPLVLERPPP 8 E G+ + E + PGDPLVLERPPP Sbjct: 16 ELGNMWNVEGSNSCSPGDPLVLERPPP 42 >SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 32.3 bits (70), Expect = 0.41 Identities = 16/23 (69%), Positives = 17/23 (73%) Frame = -2 Query: 76 SVSFERN*LSRPGDPLVLERPPP 8 S+S N S PGDPLVLERPPP Sbjct: 31 SISLISNSCS-PGDPLVLERPPP 52 >SB_21334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 32.3 bits (70), Expect = 0.41 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = -2 Query: 76 SVSFERN*LSRPGDPLVLERPPP 8 S+S + PGDPLVLERPPP Sbjct: 5 SLSLRASNSCSPGDPLVLERPPP 27 >SB_19713| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 507 Score = 32.3 bits (70), Expect = 0.41 Identities = 13/19 (68%), Positives = 15/19 (78%) Frame = -2 Query: 64 ERN*LSRPGDPLVLERPPP 8 + N + PGDPLVLERPPP Sbjct: 89 KNNAVPGPGDPLVLERPPP 107 >SB_18165| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 173 Score = 32.3 bits (70), Expect = 0.41 Identities = 15/29 (51%), Positives = 19/29 (65%), Gaps = 2/29 (6%) Frame = -2 Query: 88 EHGSSVSFERN*LSR--PGDPLVLERPPP 8 E+G ++ E + PGDPLVLERPPP Sbjct: 38 EYGKAIEAEEGQSNSCSPGDPLVLERPPP 66 >SB_12393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 32.3 bits (70), Expect = 0.41 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -2 Query: 70 SFERN*LSRPGDPLVLERPPP 8 S E + PGDPLVLERPPP Sbjct: 8 SLESSNSCSPGDPLVLERPPP 28 >SB_5609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 32.3 bits (70), Expect = 0.41 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -2 Query: 46 RPGDPLVLERPPP 8 +PGDPLVLERPPP Sbjct: 36 QPGDPLVLERPPP 48 >SB_5183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 32.3 bits (70), Expect = 0.41 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = +1 Query: 10 VAAALELVDPPACLINSFQMK 72 VAAALELVDPP C NS +MK Sbjct: 9 VAAALELVDPPGCR-NSMKMK 28 >SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 2 PGDPLVLERPPP 13 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 17 PGDPLVLERPPP 28 >SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 15 PGDPLVLERPPP 26 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 40 PGDPLVLERPPP 51 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 31 PGDPLVLERPPP 42 >SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 2 PGDPLVLERPPP 13 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 8 PGDPLVLERPPP 19 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 23 PGDPLVLERPPP 34 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 32 PGDPLVLERPPP 43 >SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 13 PGDPLVLERPPP 24 >SB_58229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 2 PGDPLVLERPPP 13 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 189 PGDPLVLERPPP 200 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 84 PGDPLVLERPPP 95 >SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 2 PGDPLVLERPPP 13 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 20 PGDPLVLERPPP 31 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 354 PGDPLVLERPPP 365 >SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 2 PGDPLVLERPPP 13 >SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 2 PGDPLVLERPPP 13 >SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 12 PGDPLVLERPPP 23 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 11 PGDPLVLERPPP 22 >SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 2 PGDPLVLERPPP 13 >SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 18 PGDPLVLERPPP 29 >SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 313 PGDPLVLERPPP 324 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 23 PGDPLVLERPPP 34 >SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 2 PGDPLVLERPPP 13 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 32 PGDPLVLERPPP 43 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 16 PGDPLVLERPPP 27 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 107 PGDPLVLERPPP 118 >SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 2 PGDPLVLERPPP 13 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 36 PGDPLVLERPPP 47 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 12 PGDPLVLERPPP 23 >SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 2 PGDPLVLERPPP 13 >SB_55981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 2 PGDPLVLERPPP 13 >SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 2 PGDPLVLERPPP 13 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 9 PGDPLVLERPPP 20 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 87 PGDPLVLERPPP 98 >SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 7 PGDPLVLERPPP 18 >SB_55207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 2 PGDPLVLERPPP 13 >SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 2 PGDPLVLERPPP 13 >SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 92 PGDPLVLERPPP 103 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 387 PGDPLVLERPPP 398 >SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 2 PGDPLVLERPPP 13 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 29 PGDPLVLERPPP 40 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 19 PGDPLVLERPPP 30 >SB_53988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 2 PGDPLVLERPPP 13 >SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 2 PGDPLVLERPPP 13 >SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 27 PGDPLVLERPPP 38 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 36 PGDPLVLERPPP 47 >SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 2 PGDPLVLERPPP 13 >SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 2 PGDPLVLERPPP 13 >SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 2 PGDPLVLERPPP 13 >SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 300 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 158 PGDPLVLERPPP 169 >SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 7 PGDPLVLERPPP 18 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 13 PGDPLVLERPPP 24 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 27 PGDPLVLERPPP 38 >SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 142 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 24 PGDPLVLERPPP 35 >SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 2 PGDPLVLERPPP 13 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 8 PGDPLVLERPPP 19 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 12 PGDPLVLERPPP 23 >SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 2 PGDPLVLERPPP 13 >SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 57 PGDPLVLERPPP 68 >SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 2 PGDPLVLERPPP 13 >SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) Length = 473 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 313 PGDPLVLERPPP 324 >SB_51855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 2 PGDPLVLERPPP 13 >SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 2 PGDPLVLERPPP 13 >SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 2 PGDPLVLERPPP 13 >SB_51214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 2 PGDPLVLERPPP 13 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 59 PGDPLVLERPPP 70 >SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 9 PGDPLVLERPPP 20 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 267 PGDPLVLERPPP 278 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 30 PGDPLVLERPPP 41 >SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 857 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 384 PGDPLVLERPPP 395 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 24 PGDPLVLERPPP 35 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 16 PGDPLVLERPPP 27 >SB_50043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 2 PGDPLVLERPPP 13 >SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 66 PGDPLVLERPPP 77 >SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 16 PGDPLVLERPPP 27 >SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 2 PGDPLVLERPPP 13 >SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 24 PGDPLVLERPPP 35 >SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) Length = 286 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 168 PGDPLVLERPPP 179 >SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 26 PGDPLVLERPPP 37 >SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 237 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 59 PGDPLVLERPPP 70 >SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 2 PGDPLVLERPPP 13 >SB_48300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 2 PGDPLVLERPPP 13 >SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 2 PGDPLVLERPPP 13 >SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 2 PGDPLVLERPPP 13 >SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 40 PGDPLVLERPPP 51 >SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 23 PGDPLVLERPPP 34 >SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 2 PGDPLVLERPPP 13 >SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 2 PGDPLVLERPPP 13 >SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 69 PGDPLVLERPPP 80 >SB_46947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 2 PGDPLVLERPPP 13 >SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 754 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 636 PGDPLVLERPPP 647 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 21 PGDPLVLERPPP 32 >SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 10 PGDPLVLERPPP 21 >SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 2 PGDPLVLERPPP 13 >SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 2 PGDPLVLERPPP 13 >SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 9 PGDPLVLERPPP 20 >SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) Length = 134 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 16 PGDPLVLERPPP 27 >SB_45923| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 2 PGDPLVLERPPP 13 >SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 2 PGDPLVLERPPP 13 >SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 53 PGDPLVLERPPP 64 >SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 18 PGDPLVLERPPP 29 >SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 2 PGDPLVLERPPP 13 >SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 2 PGDPLVLERPPP 13 >SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) Length = 1016 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 898 PGDPLVLERPPP 909 >SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 19 PGDPLVLERPPP 30 >SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 30 PGDPLVLERPPP 41 >SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 2 PGDPLVLERPPP 13 >SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 2 PGDPLVLERPPP 13 >SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 2 PGDPLVLERPPP 13 >SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 19 PGDPLVLERPPP 30 >SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 2 PGDPLVLERPPP 13 >SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) Length = 166 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 48 PGDPLVLERPPP 59 >SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 2 PGDPLVLERPPP 13 >SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 2 PGDPLVLERPPP 13 >SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 217 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 99 PGDPLVLERPPP 110 >SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 70 PGDPLVLERPPP 81 >SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 77 PGDPLVLERPPP 88 >SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) Length = 999 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 881 PGDPLVLERPPP 892 >SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) Length = 130 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 12 PGDPLVLERPPP 23 >SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 16 PGDPLVLERPPP 27 >SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 68 PGDPLVLERPPP 79 >SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 54 PGDPLVLERPPP 65 >SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 10 PGDPLVLERPPP 21 >SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 29 PGDPLVLERPPP 40 >SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 23 PGDPLVLERPPP 34 >SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 2 PGDPLVLERPPP 13 >SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 25 PGDPLVLERPPP 36 >SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 69 PGDPLVLERPPP 80 >SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 48 PGDPLVLERPPP 59 >SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 31 PGDPLVLERPPP 42 >SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 44 PGDPLVLERPPP 55 >SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 20 PGDPLVLERPPP 31 >SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 26 PGDPLVLERPPP 37 >SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 2 PGDPLVLERPPP 13 >SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 203 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 85 PGDPLVLERPPP 96 >SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 35 PGDPLVLERPPP 46 >SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 43 PGDPLVLERPPP 8 PGDPLVLERPPP Sbjct: 46 PGDPLVLERPPP 57 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,335,225 Number of Sequences: 59808 Number of extensions: 366253 Number of successful extensions: 2562 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 2511 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2562 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1913853903 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -