Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30499
         (719 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g72540.1 68414.m08388 protein kinase, putative similar to aux...    27   9.5  

>At1g72540.1 68414.m08388 protein kinase, putative similar to
           auxin-regulated dual specificity cytosolic kinase
           [Lycopersicon esculentum] gi|14484938|gb|AAK62821;
           similar to serine/threonine protein kinase
           gi|1066501|gb|AAA81538
          Length = 450

 Score = 27.5 bits (58), Expect = 9.5
 Identities = 17/56 (30%), Positives = 27/56 (48%)
 Frame = +1

Query: 37  PPACLINSFQMKRSCHAPFTSSLFLLCSRAVIKSKRNR*KYSSQITVSYKDFLNCF 204
           P +C+ N+ Q K +   P    L LL  +  + S+     +S+  T+S  DF N F
Sbjct: 11  PISCINNTNQKKTTTTNPPKEKLLLLSRQTSVPSRVYMSDFSNS-TISLNDFSNSF 65


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,523,528
Number of Sequences: 28952
Number of extensions: 248271
Number of successful extensions: 435
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 429
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 435
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1565336320
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)