BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30499 (719 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g72540.1 68414.m08388 protein kinase, putative similar to aux... 27 9.5 >At1g72540.1 68414.m08388 protein kinase, putative similar to auxin-regulated dual specificity cytosolic kinase [Lycopersicon esculentum] gi|14484938|gb|AAK62821; similar to serine/threonine protein kinase gi|1066501|gb|AAA81538 Length = 450 Score = 27.5 bits (58), Expect = 9.5 Identities = 17/56 (30%), Positives = 27/56 (48%) Frame = +1 Query: 37 PPACLINSFQMKRSCHAPFTSSLFLLCSRAVIKSKRNR*KYSSQITVSYKDFLNCF 204 P +C+ N+ Q K + P L LL + + S+ +S+ T+S DF N F Sbjct: 11 PISCINNTNQKKTTTTNPPKEKLLLLSRQTSVPSRVYMSDFSNS-TISLNDFSNSF 65 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,523,528 Number of Sequences: 28952 Number of extensions: 248271 Number of successful extensions: 435 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 429 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 435 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1565336320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -