BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30496 (563 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC32H8.10 |cdk9||cyclin-dependent protein kinase Cdk9 |Schizos... 27 1.9 SPAC11E3.13c |||1,3-beta-glucanosyltransferase |Schizosaccharomy... 27 2.5 SPAC23H3.15c ||SPAC25H1.01c|sequence orphan|Schizosaccharomyces ... 25 5.8 >SPBC32H8.10 |cdk9||cyclin-dependent protein kinase Cdk9 |Schizosaccharomyces pombe|chr 2|||Manual Length = 591 Score = 27.1 bits (57), Expect = 1.9 Identities = 14/45 (31%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Frame = +3 Query: 36 QNNSYNVQENHEPSDGGQSYRPTSNIHSFEGSPS-YSQDAAQFSE 167 + N+ N NH +DG + YRP + +PS Y + Q S+ Sbjct: 455 ETNAMNQTSNHSHADGQRYYRPEQDRSQRLRNPSDYGRQGRQSSQ 499 >SPAC11E3.13c |||1,3-beta-glucanosyltransferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 510 Score = 26.6 bits (56), Expect = 2.5 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +3 Query: 132 PSYSQDAAQFSEEYAGTPSGYNAPT 206 P+ +A F E AG P G+NAP+ Sbjct: 366 PTMPSEAKGFIESGAGQPLGFNAPS 390 >SPAC23H3.15c ||SPAC25H1.01c|sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 325 Score = 25.4 bits (53), Expect = 5.8 Identities = 12/53 (22%), Positives = 24/53 (45%) Frame = +3 Query: 9 SHEASEDGVQNNSYNVQENHEPSDGGQSYRPTSNIHSFEGSPSYSQDAAQFSE 167 S + +N Y+ N S GG++ +++ S+ PS + D A + + Sbjct: 103 SRRHDDSSYSSNKYSTGGNDSYSSGGRNEDYSTSGGSYTTDPSRTDDTASYGQ 155 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,294,370 Number of Sequences: 5004 Number of extensions: 46482 Number of successful extensions: 148 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 142 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 148 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 238029836 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -