Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30496
         (563 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY324310-1|AAQ89695.1|  160|Anopheles gambiae insulin-like pepti...    23   6.9  
AY748849-1|AAV28195.1|  106|Anopheles gambiae cytochrome P450 pr...    23   9.1  

>AY324310-1|AAQ89695.1|  160|Anopheles gambiae insulin-like peptide
           4 precursor protein.
          Length = 160

 Score = 23.0 bits (47), Expect = 6.9
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = -3

Query: 264 SYWYVQKYYHRF 229
           S W+ QK YHRF
Sbjct: 108 SMWFRQKPYHRF 119


>AY748849-1|AAV28195.1|  106|Anopheles gambiae cytochrome P450
           protein.
          Length = 106

 Score = 22.6 bits (46), Expect = 9.1
 Identities = 11/31 (35%), Positives = 15/31 (48%), Gaps = 1/31 (3%)
 Frame = +3

Query: 108 NIHSFEGSPSYSQDAAQF-SEEYAGTPSGYN 197
           NI+  +  P Y  DA QF  E +   P  Y+
Sbjct: 41  NIYVMQNDPQYYPDADQFRPERFLQEPPPYS 71


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 583,223
Number of Sequences: 2352
Number of extensions: 12259
Number of successful extensions: 31
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 30
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 31
length of database: 563,979
effective HSP length: 61
effective length of database: 420,507
effective search space used: 52983882
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)