BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30488 (364 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_50641| Best HMM Match : Rad21_Rec8_N (HMM E-Value=0) 35 0.023 SB_50497| Best HMM Match : CH (HMM E-Value=0.0084) 31 0.37 SB_15028| Best HMM Match : Drf_FH1 (HMM E-Value=0.84) 31 0.37 SB_12832| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.5 SB_26886| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.4 SB_24046| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.4 SB_44878| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.4 SB_42146| Best HMM Match : GYF (HMM E-Value=5.7e-15) 27 4.6 SB_9006| Best HMM Match : WSC (HMM E-Value=0.85) 27 4.6 SB_3407| Best HMM Match : TPX2 (HMM E-Value=2.9e-09) 27 4.6 SB_34508| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.6 SB_32053| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.6 SB_22693| Best HMM Match : DUF1042 (HMM E-Value=0.00027) 27 4.6 SB_8591| Best HMM Match : DUF601 (HMM E-Value=0.23) 27 4.6 SB_56294| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.0 SB_38173| Best HMM Match : PAN (HMM E-Value=0.0013) 27 6.0 SB_47662| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.0 SB_59028| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-05) 26 8.0 SB_58769| Best HMM Match : XPA_C (HMM E-Value=0.01) 26 8.0 SB_32131| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.0 SB_29995| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-05) 26 8.0 SB_10847| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.0 SB_10584| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.0 SB_6777| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.0 SB_54962| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.0 SB_50665| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.0 SB_41328| Best HMM Match : NLPC_P60 (HMM E-Value=5.8) 26 8.0 SB_30304| Best HMM Match : fn3 (HMM E-Value=1.5e-32) 26 8.0 SB_25521| Best HMM Match : NLPC_P60 (HMM E-Value=5.7) 26 8.0 SB_22842| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.0 SB_19834| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.0 SB_15549| Best HMM Match : ADH_zinc_N (HMM E-Value=9.4e-13) 26 8.0 SB_15157| Best HMM Match : DUF1153 (HMM E-Value=1.7) 26 8.0 SB_5598| Best HMM Match : C1_1 (HMM E-Value=0.87) 26 8.0 SB_993| Best HMM Match : rve (HMM E-Value=2.7e-33) 26 8.0 >SB_50641| Best HMM Match : Rad21_Rec8_N (HMM E-Value=0) Length = 816 Score = 34.7 bits (76), Expect = 0.023 Identities = 19/69 (27%), Positives = 38/69 (55%), Gaps = 1/69 (1%) Frame = +1 Query: 22 DIAKPSESNPPTETKPEQPAAGPLKQIFENSPVLQGIAGAVKKIQT-TVNNPVKPRDSEV 198 DI KP+ PPT+T+ ++++F N P+++ AG + + T + N + ++ Sbjct: 587 DIVKPATLAPPTKTRKRLKKRSKVEELFAN-PMVELFAGPLVECFTENLTNKIAEDSAQK 645 Query: 199 VEETKSEQE 225 EE +SE++ Sbjct: 646 EEEEESEEK 654 >SB_50497| Best HMM Match : CH (HMM E-Value=0.0084) Length = 2086 Score = 30.7 bits (66), Expect = 0.37 Identities = 22/101 (21%), Positives = 36/101 (35%) Frame = +1 Query: 31 KPSESNPPTETKPEQPAAGPLKQIFENSPVLQGIAGAVKKIQTTVNNPVKPRDSEVVEET 210 +PS P++ P P+ G + + + IA ++ V + KP E Sbjct: 1515 EPSPGGSPSDLSPTDPSPG--ESPHPEADLSTEIAPPLEAAPNAVEDEAKPESERSGEPA 1572 Query: 211 KSEQEKGGVILLPVQVTAVTVEMVGIITTSVTG*KRKPKKS 333 + K V V TAV + S T + P K+ Sbjct: 1573 DEHKLKEAVAAAAVTATAVATTGAAVAAASATTKGKSPSKT 1613 >SB_15028| Best HMM Match : Drf_FH1 (HMM E-Value=0.84) Length = 944 Score = 30.7 bits (66), Expect = 0.37 Identities = 22/101 (21%), Positives = 36/101 (35%) Frame = +1 Query: 31 KPSESNPPTETKPEQPAAGPLKQIFENSPVLQGIAGAVKKIQTTVNNPVKPRDSEVVEET 210 +PS P++ P P+ G + + + IA ++ V + KP E Sbjct: 410 EPSPGGSPSDLSPTDPSPG--ESPHPEADLSTEIAPPLEAAPNAVEDEAKPESERSGEPA 467 Query: 211 KSEQEKGGVILLPVQVTAVTVEMVGIITTSVTG*KRKPKKS 333 + K V V TAV + S T + P K+ Sbjct: 468 DEHKLKEAVAAAAVTATAVATTGAAVAAASATTKGKSPSKT 508 >SB_12832| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1169 Score = 28.7 bits (61), Expect = 1.5 Identities = 18/76 (23%), Positives = 31/76 (40%) Frame = -3 Query: 242 KMTPPFSCSDLVSSTTSESLGFTGLLTVVWIFLTAPAMPCRTGLFSKICFNGPAAGCSGF 63 +M P + +++ + L F L+T + P +PC TG++S + C Sbjct: 66 EMLPVVDAQEAINALMEQRLKFVPLVTSHQMVPRVPPVPCPTGMYSLGAASMNCTACPAG 125 Query: 62 VSVGGFDSDGFAMSGA 15 S + A SGA Sbjct: 126 FSCSDPAAPPAACSGA 141 >SB_26886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6489 Score = 27.5 bits (58), Expect = 3.4 Identities = 20/77 (25%), Positives = 29/77 (37%) Frame = +1 Query: 1 GVASAAPDIAKPSESNPPTETKPEQPAAGPLKQIFENSPVLQGIAGAVKKIQTTVNNPVK 180 G AS PS ++ P K++ +S + + K QTT PV Sbjct: 4211 GTASTKSAQVHPSTTHNGLPVSTAAPTTNGRKEVSSSSS--RHVLDETKTFQTTKAAPVS 4268 Query: 181 PRDSEVVEETKSEQEKG 231 D + E+ K EKG Sbjct: 4269 TGDPKPPEQNKGIDEKG 4285 >SB_24046| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2848 Score = 27.5 bits (58), Expect = 3.4 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +1 Query: 7 ASAAPDIAKPSESNPPTETKPEQPAAGPLKQIFENSPV 120 AS++ + + P S PPT TK P+ G Q +PV Sbjct: 1008 ASSSSNHSTPVNSAPPTPTKNATPSKGTPGQSTSGTPV 1045 >SB_44878| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1338 Score = 27.5 bits (58), Expect = 3.4 Identities = 14/59 (23%), Positives = 27/59 (45%) Frame = +1 Query: 49 PPTETKPEQPAAGPLKQIFENSPVLQGIAGAVKKIQTTVNNPVKPRDSEVVEETKSEQE 225 PPT+TK P K++ N + +K++ ++ ++ + E V K E+E Sbjct: 492 PPTQTKKGNRLMSPTKELLTNKQQNKANPAVIKELSRPPSS-IRAKQGERVVSPKEEKE 549 >SB_42146| Best HMM Match : GYF (HMM E-Value=5.7e-15) Length = 924 Score = 27.1 bits (57), Expect = 4.6 Identities = 25/81 (30%), Positives = 34/81 (41%), Gaps = 8/81 (9%) Frame = +1 Query: 10 SAAPDIAKPSESNPPTE----TKPEQPAAGPLKQIFENSPVL----QGIAGAVKKIQTTV 165 S P AKP PPT T P QP+ + + SP L + + ++ Sbjct: 283 SPQPTEAKPHTPPPPTSTPPTTAPRQPSPMAPAPVQKESPPLTDDRKDEEQGIDHLEKAA 342 Query: 166 NNPVKPRDSEVVEETKSEQEK 228 N V D E +E KSEQE+ Sbjct: 343 ENLVLLLDDE--DEEKSEQER 361 >SB_9006| Best HMM Match : WSC (HMM E-Value=0.85) Length = 441 Score = 27.1 bits (57), Expect = 4.6 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = -2 Query: 207 LFNHFRISWLHWIIDCCLDFFNCS 136 +FN RI WLHW D L F CS Sbjct: 136 VFNGKRIDWLHW--DTYLPEFICS 157 >SB_3407| Best HMM Match : TPX2 (HMM E-Value=2.9e-09) Length = 787 Score = 27.1 bits (57), Expect = 4.6 Identities = 17/69 (24%), Positives = 27/69 (39%) Frame = +1 Query: 43 SNPPTETKPEQPAAGPLKQIFENSPVLQGIAGAVKKIQTTVNNPVKPRDSEVVEETKSEQ 222 S PP+E QP P+K+ +SP+L K + +PR + S+ Sbjct: 197 SAPPSEKNAFQP---PMKKTKPSSPLLTRARANAAKAPRKSHRQSRPRTASTCSNASSKS 253 Query: 223 EKGGVILLP 249 E + P Sbjct: 254 EGDNCVFQP 262 >SB_34508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 27.1 bits (57), Expect = 4.6 Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 2/33 (6%) Frame = +1 Query: 34 PSESNPPTETKPE--QPAAGPLKQIFENSPVLQ 126 P + P ETKPE Q A KQ+ + SP++Q Sbjct: 148 PVKPEPKPETKPEAKQEAKPEAKQVTKPSPIVQ 180 >SB_32053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 27.1 bits (57), Expect = 4.6 Identities = 12/28 (42%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Frame = +1 Query: 7 ASAAPD-IAKPSESNPPTETKPEQPAAG 87 A+A+P +AKP ++PP+ KP P G Sbjct: 299 AAASPKPVAKPIPASPPSTGKPSPPPLG 326 >SB_22693| Best HMM Match : DUF1042 (HMM E-Value=0.00027) Length = 2261 Score = 27.1 bits (57), Expect = 4.6 Identities = 15/65 (23%), Positives = 26/65 (40%) Frame = +1 Query: 31 KPSESNPPTETKPEQPAAGPLKQIFENSPVLQGIAGAVKKIQTTVNNPVKPRDSEVVEET 210 +P E PP T P +P G + + P+ + A + K V + V + Sbjct: 1252 EPEEEKPPEPTGPPEPEPGSEEWEYVAQPIDKEFADVLSKQWEIVEDTYVATCKHVFRDI 1311 Query: 211 KSEQE 225 + E+E Sbjct: 1312 RHEKE 1316 >SB_8591| Best HMM Match : DUF601 (HMM E-Value=0.23) Length = 3368 Score = 27.1 bits (57), Expect = 4.6 Identities = 24/103 (23%), Positives = 42/103 (40%), Gaps = 3/103 (2%) Frame = +1 Query: 31 KPSESNPPTETKPEQPAAGPLKQ---IFENSPVLQGIAGAVKKIQTTVNNPVKPRDSEVV 201 K + P TK P +K + +PV + + +I TV +PVK Sbjct: 1626 KYEDQKPLLSTKTSDPTVSIVKNRETSYFCTPVGTIVISSCSQITNTVVSPVKKDSDMCT 1685 Query: 202 EETKSEQEKGGVILLPVQVTAVTVEMVGIITTSVTG*KRKPKK 330 ++ +++Q+K L VQ + V + TG + PK+ Sbjct: 1686 QDAETQQKK----LEDVQQKSKEVTCAAVSVEGSTGARSVPKQ 1724 >SB_56294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 520 Score = 26.6 bits (56), Expect = 6.0 Identities = 19/61 (31%), Positives = 29/61 (47%), Gaps = 1/61 (1%) Frame = +1 Query: 7 ASAAPDIAKPSESNPPTETKPEQPAAGPL-KQIFENSPVLQGIAGAVKKIQTTVNNPVKP 183 A AAPD+ E P T ++PA L Q SP Q I + +++ ++ P +P Sbjct: 128 APAAPDVTADREPAAPDVTADQKPAMQDLPTQAPRGSPEYQSITRSQQELAASMLLP-QP 186 Query: 184 R 186 R Sbjct: 187 R 187 >SB_38173| Best HMM Match : PAN (HMM E-Value=0.0013) Length = 340 Score = 26.6 bits (56), Expect = 6.0 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +1 Query: 31 KPSESNPPTETKPEQPAAGP 90 KP++S PTE+KP P + P Sbjct: 205 KPTKSTKPTESKPTAPTSLP 224 >SB_47662| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 559 Score = 26.6 bits (56), Expect = 6.0 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = -3 Query: 290 IIPTISTVTAVTCTGNKMTPPFSCSDLVSSTTSESLGFTG 171 ++P+ + GN P C DLV+S S S+ TG Sbjct: 486 VVPSYPVTSYTGYYGNFPMPRVLCDDLVASPASSSVSPTG 525 >SB_59028| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-05) Length = 362 Score = 26.2 bits (55), Expect = 8.0 Identities = 9/12 (75%), Positives = 12/12 (100%) Frame = +1 Query: 328 KSRYPQKKNRKR 363 +S+YP+KKNRKR Sbjct: 344 RSKYPEKKNRKR 355 >SB_58769| Best HMM Match : XPA_C (HMM E-Value=0.01) Length = 123 Score = 26.2 bits (55), Expect = 8.0 Identities = 18/63 (28%), Positives = 29/63 (46%) Frame = +1 Query: 40 ESNPPTETKPEQPAAGPLKQIFENSPVLQGIAGAVKKIQTTVNNPVKPRDSEVVEETKSE 219 E N T+ P + P+K IF+ S V ++ + K + +V ETK+E Sbjct: 38 ELNHETKDNPINKSYPPMK-IFKLSEVKSKAVEVWGSLEKLEDEKTKRKQKKVNVETKNE 96 Query: 220 QEK 228 +EK Sbjct: 97 EEK 99 >SB_32131| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 26.2 bits (55), Expect = 8.0 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +1 Query: 25 IAKPSESNPPTETKPEQPA 81 I P ESNPP + PE P+ Sbjct: 67 IQDPIESNPPVDQPPEPPS 85 >SB_29995| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-05) Length = 362 Score = 26.2 bits (55), Expect = 8.0 Identities = 9/12 (75%), Positives = 12/12 (100%) Frame = +1 Query: 328 KSRYPQKKNRKR 363 +S+YP+KKNRKR Sbjct: 344 RSKYPEKKNRKR 355 >SB_10847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 26.2 bits (55), Expect = 8.0 Identities = 9/12 (75%), Positives = 12/12 (100%) Frame = +1 Query: 328 KSRYPQKKNRKR 363 +S+YP+KKNRKR Sbjct: 115 RSKYPEKKNRKR 126 >SB_10584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 26.2 bits (55), Expect = 8.0 Identities = 9/12 (75%), Positives = 12/12 (100%) Frame = +1 Query: 328 KSRYPQKKNRKR 363 +S+YP+KKNRKR Sbjct: 113 RSKYPEKKNRKR 124 >SB_6777| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 26.2 bits (55), Expect = 8.0 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +1 Query: 25 IAKPSESNPPTETKPEQPA 81 I P ESNPP + PE P+ Sbjct: 144 IQDPIESNPPVDQPPEPPS 162 >SB_54962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2211 Score = 26.2 bits (55), Expect = 8.0 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +1 Query: 25 IAKPSESNPPTETKPEQPA 81 I P ESNPP + PE P+ Sbjct: 2172 IQDPIESNPPVDQPPEPPS 2190 >SB_50665| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 625 Score = 26.2 bits (55), Expect = 8.0 Identities = 9/12 (75%), Positives = 12/12 (100%) Frame = +1 Query: 328 KSRYPQKKNRKR 363 +S+YP+KKNRKR Sbjct: 607 RSKYPEKKNRKR 618 >SB_41328| Best HMM Match : NLPC_P60 (HMM E-Value=5.8) Length = 155 Score = 26.2 bits (55), Expect = 8.0 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +1 Query: 25 IAKPSESNPPTETKPEQPA 81 I P ESNPP + PE P+ Sbjct: 116 IQDPIESNPPVDQPPEPPS 134 >SB_30304| Best HMM Match : fn3 (HMM E-Value=1.5e-32) Length = 808 Score = 26.2 bits (55), Expect = 8.0 Identities = 14/52 (26%), Positives = 20/52 (38%) Frame = +1 Query: 151 IQTTVNNPVKPRDSEVVEETKSEQEKGGVILLPVQVTAVTVEMVGIITTSVT 306 + T + NP P SE S K + L PV+ T + +I T Sbjct: 411 VDTEIENPKAPNVSEPATVNGSSSGKANITLWPVKQTNGPISFYQVIVADRT 462 >SB_25521| Best HMM Match : NLPC_P60 (HMM E-Value=5.7) Length = 212 Score = 26.2 bits (55), Expect = 8.0 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +1 Query: 25 IAKPSESNPPTETKPEQPA 81 I P ESNPP + PE P+ Sbjct: 173 IQDPIESNPPVDQPPEPPS 191 >SB_22842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 757 Score = 26.2 bits (55), Expect = 8.0 Identities = 9/12 (75%), Positives = 12/12 (100%) Frame = +1 Query: 328 KSRYPQKKNRKR 363 +S+YP+KKNRKR Sbjct: 739 RSKYPEKKNRKR 750 >SB_19834| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 26.2 bits (55), Expect = 8.0 Identities = 14/52 (26%), Positives = 22/52 (42%) Frame = +1 Query: 19 PDIAKPSESNPPTETKPEQPAAGPLKQIFENSPVLQGIAGAVKKIQTTVNNP 174 P I P+ + P ETK +P+ P + N P + A + + T P Sbjct: 33 PSIPDPTIAMVPLETKTRKPSRDPTQPRLGNKPPVPDPAIPMVPLATKTRKP 84 >SB_15549| Best HMM Match : ADH_zinc_N (HMM E-Value=9.4e-13) Length = 562 Score = 26.2 bits (55), Expect = 8.0 Identities = 19/60 (31%), Positives = 24/60 (40%) Frame = +1 Query: 19 PDIAKPSESNPPTETKPEQPAAGPLKQIFENSPVLQGIAGAVKKIQTTVNNPVKPRDSEV 198 P+ AKP E ++KPE+ A E P K +T V KP SEV Sbjct: 504 PEEAKPEEPKEDEKSKPEETKAEE-----EAKPEAPKAEEEAKPGETKVEEEAKPDSSEV 558 >SB_15157| Best HMM Match : DUF1153 (HMM E-Value=1.7) Length = 412 Score = 26.2 bits (55), Expect = 8.0 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +1 Query: 25 IAKPSESNPPTETKPEQPA 81 I P ESNPP + PE P+ Sbjct: 373 IQDPIESNPPVDQPPEPPS 391 >SB_5598| Best HMM Match : C1_1 (HMM E-Value=0.87) Length = 296 Score = 26.2 bits (55), Expect = 8.0 Identities = 9/12 (75%), Positives = 12/12 (100%) Frame = +1 Query: 328 KSRYPQKKNRKR 363 +S+YP+KKNRKR Sbjct: 278 RSKYPEKKNRKR 289 >SB_993| Best HMM Match : rve (HMM E-Value=2.7e-33) Length = 735 Score = 26.2 bits (55), Expect = 8.0 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +1 Query: 25 IAKPSESNPPTETKPEQPA 81 I P ESNPP + PE P+ Sbjct: 696 IQDPIESNPPVDQPPEPPS 714 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.310 0.129 0.353 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,374,958 Number of Sequences: 59808 Number of extensions: 188051 Number of successful extensions: 708 Number of sequences better than 10.0: 35 Number of HSP's better than 10.0 without gapping: 568 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 707 length of database: 16,821,457 effective HSP length: 74 effective length of database: 12,395,665 effective search space used: 570200590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.8 bits)
- SilkBase 1999-2023 -