BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30487 (750 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 23 4.0 EF493864-1|ABP65286.1| 247|Apis mellifera triosephoshpate isome... 22 7.1 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 22 7.1 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 22 7.1 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 22.6 bits (46), Expect = 4.0 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +1 Query: 124 GGNQSSVDILIKPNVVENITRVFKRESIDY 213 G N S+ D+L K N E T R++ DY Sbjct: 149 GSNSSNSDVLFKQNKEEEQT--INRKNSDY 176 >EF493864-1|ABP65286.1| 247|Apis mellifera triosephoshpate isomerase protein. Length = 247 Score = 21.8 bits (44), Expect = 7.1 Identities = 5/12 (41%), Positives = 10/12 (83%) Frame = +3 Query: 645 LPWIVLGREEQK 680 +PW++LG E++ Sbjct: 87 IPWVILGHSERR 98 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.8 bits (44), Expect = 7.1 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = +2 Query: 650 VDRPWEGRTESLGYRACTW 706 V+R ++G + +GY C W Sbjct: 472 VNRFYDGIRDMIGYYPCCW 490 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.8 bits (44), Expect = 7.1 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = +2 Query: 650 VDRPWEGRTESLGYRACTW 706 V+R ++G + +GY C W Sbjct: 525 VNRFYDGIRDMIGYYPCCW 543 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 222,797 Number of Sequences: 438 Number of extensions: 5181 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23510295 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -