BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30481 (638 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. 23 2.1 AY600516-1|AAT11864.1| 143|Tribolium castaneum optomotor-blind-... 22 3.8 AY600515-1|AAT11863.1| 134|Tribolium castaneum optomotor-blind-... 22 3.8 U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. 21 8.7 U81038-1|AAB39355.1| 412|Tribolium castaneum transcription fact... 21 8.7 AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. 21 8.7 >U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. Length = 425 Score = 23.0 bits (47), Expect = 2.1 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = -2 Query: 103 TTSNNFWHPVAGYETFNFMTAVNPVEPR 20 +TSNN WH G + N NP + R Sbjct: 370 STSNNRWHNNNGNNSNNHWRKNNPNDNR 397 >AY600516-1|AAT11864.1| 143|Tribolium castaneum optomotor-blind-like protein protein. Length = 143 Score = 22.2 bits (45), Expect = 3.8 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = +3 Query: 48 MKLNVSYPATGCQKLFEVVDEHKLRI 125 M ++ P+TG Q + +VV HKL++ Sbjct: 54 MYIHPDSPSTGEQWMQKVVSFHKLKL 79 >AY600515-1|AAT11863.1| 134|Tribolium castaneum optomotor-blind-like protein protein. Length = 134 Score = 22.2 bits (45), Expect = 3.8 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = +3 Query: 48 MKLNVSYPATGCQKLFEVVDEHKLRI 125 M ++ P+TG Q + +VV HKL++ Sbjct: 54 MYIHPDSPSTGEQWMQKVVSFHKLKL 79 >U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. Length = 283 Score = 21.0 bits (42), Expect = 8.7 Identities = 12/43 (27%), Positives = 18/43 (41%) Frame = -3 Query: 207 QRHEVHSPSIHRLTDQPLLRRPCAFRKRYEACARPPLRTTSGI 79 Q H H P IH P+L + +PP+ ++S I Sbjct: 88 QLHSHHGPPIHHQIRPPILHDTQPMCESLN--TQPPVTSSSNI 128 >U81038-1|AAB39355.1| 412|Tribolium castaneum transcription factor Deformed protein. Length = 412 Score = 21.0 bits (42), Expect = 8.7 Identities = 12/43 (27%), Positives = 18/43 (41%) Frame = -3 Query: 207 QRHEVHSPSIHRLTDQPLLRRPCAFRKRYEACARPPLRTTSGI 79 Q H H P IH P+L + +PP+ ++S I Sbjct: 88 QLHSHHGPPIHHQIRPPILHDTQPMCESLN--TQPPVTSSSNI 128 >AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. Length = 412 Score = 21.0 bits (42), Expect = 8.7 Identities = 12/43 (27%), Positives = 18/43 (41%) Frame = -3 Query: 207 QRHEVHSPSIHRLTDQPLLRRPCAFRKRYEACARPPLRTTSGI 79 Q H H P IH P+L + +PP+ ++S I Sbjct: 88 QLHSHHGPPIHHQIRPPILHDTQPMCESLN--TQPPVTSSSNI 128 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 154,089 Number of Sequences: 336 Number of extensions: 3300 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16501678 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -