BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30481 (638 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcript... 26 0.88 DQ314781-1|ABC54566.1| 407|Anopheles gambiae OSKAR protein. 25 1.5 AF063021-3|AAC16247.1| 484|Anopheles gambiae dopa decarboxylase... 25 2.7 AF063021-2|AAC16249.1| 515|Anopheles gambiae dopa decarboxylase... 25 2.7 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 24 3.5 AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical prote... 24 3.5 AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical prote... 24 3.5 AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. 24 4.7 AJ618918-1|CAF01997.1| 228|Anopheles gambiae putative odorant-b... 24 4.7 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 24 4.7 AF063021-4|AAC16248.1| 93|Anopheles gambiae unknown protein. 23 6.2 AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein ... 23 6.2 AM042695-1|CAJ14970.1| 396|Anopheles gambiae 3-hydroxykynurenin... 23 8.2 >AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcriptase protein. Length = 1168 Score = 26.2 bits (55), Expect = 0.88 Identities = 11/31 (35%), Positives = 22/31 (70%) Frame = -3 Query: 429 FPSVNPGISWAPLRTITRAKTERLASTIHPR 337 +P + G + APLR+I + +++A+++HPR Sbjct: 408 WPDLGVG-NMAPLRSIGLTELDQIAASMHPR 437 >DQ314781-1|ABC54566.1| 407|Anopheles gambiae OSKAR protein. Length = 407 Score = 25.4 bits (53), Expect = 1.5 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = -1 Query: 182 PFIA*LISLYFGAHALFVKDTKLVLVHHFEQLLASRCRVRNV 57 PFIA + + G L + L+H F QL+A R R RNV Sbjct: 265 PFIADHVLVNVGTVDLLHGRAMIDLIHDFNQLVA-RFRERNV 305 >AF063021-3|AAC16247.1| 484|Anopheles gambiae dopa decarboxylase isoform 2 protein. Length = 484 Score = 24.6 bits (51), Expect = 2.7 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -3 Query: 162 QPLLRRPCAFRKRYEACAR 106 Q +RR CAF K++EA R Sbjct: 379 QAHIRRHCAFAKQFEALCR 397 >AF063021-2|AAC16249.1| 515|Anopheles gambiae dopa decarboxylase isoform 1 protein. Length = 515 Score = 24.6 bits (51), Expect = 2.7 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -3 Query: 162 QPLLRRPCAFRKRYEACAR 106 Q +RR CAF K++EA R Sbjct: 410 QAHIRRHCAFAKQFEALCR 428 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 24.2 bits (50), Expect = 3.5 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = -1 Query: 371 RPRDWRQQYIHELIYVFSLHRGAVCNMSGPLTSEDEHG 258 +P+D+R+ + L VF +GA+ ++ T ED G Sbjct: 856 KPKDFRKHSLLPLNNVFDRIKGALPHLKKSPTKEDATG 893 >AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 24.2 bits (50), Expect = 3.5 Identities = 13/45 (28%), Positives = 21/45 (46%) Frame = -3 Query: 210 RQRHEVHSPSIHRLTDQPLLRRPCAFRKRYEACARPPLRTTSGIP 76 +Q+ ++HS + + RRP + + P L TTSG P Sbjct: 25 QQQQQLHSADVPHSSTSQSSRRPQHSSTSASSSSVPTLPTTSGEP 69 >AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 24.2 bits (50), Expect = 3.5 Identities = 13/45 (28%), Positives = 21/45 (46%) Frame = -3 Query: 210 RQRHEVHSPSIHRLTDQPLLRRPCAFRKRYEACARPPLRTTSGIP 76 +Q+ ++HS + + RRP + + P L TTSG P Sbjct: 25 QQQQQLHSADVPHSSTSQSSRRPQHSSTSASSSSVPTLPTTSGEP 69 >AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. Length = 565 Score = 23.8 bits (49), Expect = 4.7 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +1 Query: 376 SCYCAQGCPGN 408 +CYC CPGN Sbjct: 73 TCYCEGHCPGN 83 >AJ618918-1|CAF01997.1| 228|Anopheles gambiae putative odorant-binding protein OBPjj2 protein. Length = 228 Score = 23.8 bits (49), Expect = 4.7 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -2 Query: 238 FIGNPCLSLPPATRS 194 F GNPCL PP ++ Sbjct: 55 FAGNPCLKGPPVPKN 69 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 23.8 bits (49), Expect = 4.7 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +2 Query: 65 VPGNGMPEVVRSGGRAQA 118 VPG+G+P SGG A Sbjct: 3225 VPGSGLPAAAASGGAPSA 3242 >AF063021-4|AAC16248.1| 93|Anopheles gambiae unknown protein. Length = 93 Score = 23.4 bits (48), Expect = 6.2 Identities = 19/61 (31%), Positives = 29/61 (47%) Frame = +2 Query: 188 LCTSCRWRQRQARIPDETGRPDNSRVRLLMSKGHSCYRPRRDGERKRKSVRGCIVDANLS 367 +CTSC WR +A RP +L ++G RP R+S R CI+ +L+ Sbjct: 1 MCTSCAWRCARA----SPSRP------ILTTRGRRWPRPPTSCWPSRRS-RLCIIALSLT 49 Query: 368 V 370 + Sbjct: 50 L 50 >AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein L5 protein. Length = 327 Score = 23.4 bits (48), Expect = 6.2 Identities = 7/17 (41%), Positives = 13/17 (76%) Frame = -1 Query: 446 LDGGVHFHQSIQEFPGH 396 +DGG++ S++ FPG+ Sbjct: 167 VDGGLNIPHSVKRFPGY 183 >AM042695-1|CAJ14970.1| 396|Anopheles gambiae 3-hydroxykynurenine transaminase protein. Length = 396 Score = 23.0 bits (47), Expect = 8.2 Identities = 13/36 (36%), Positives = 16/36 (44%) Frame = +2 Query: 386 VRKGAQEIPGLTDGNVPRRLGPKRASKIRKLFNLSK 493 V GAQ++ G G P + PK IR SK Sbjct: 199 VYTGAQKVLGAPPGITPISISPKALDVIRNRRTKSK 234 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 703,448 Number of Sequences: 2352 Number of extensions: 14809 Number of successful extensions: 33 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 33 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 62723250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -