BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30479 (392 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL021472-7|CAA16303.2| 283|Caenorhabditis elegans Hypothetical ... 28 2.7 Z66521-1|CAA91393.2| 382|Caenorhabditis elegans Hypothetical pr... 27 4.8 >AL021472-7|CAA16303.2| 283|Caenorhabditis elegans Hypothetical protein Y17D7B.6 protein. Length = 283 Score = 27.9 bits (59), Expect = 2.7 Identities = 13/50 (26%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Frame = +2 Query: 230 FNADTCAI-YFCCTECIKFGCCHERQTFNCDGFSNRSFVSDDNQ*FNVYN 376 F +++C I YF T C+ + ++ +T + SN ++V+ N+ N Sbjct: 53 FGSESCIIAYFSLTTCVFYNYVNDGKTITVEENSNNAYVAIKTNISNIPN 102 >Z66521-1|CAA91393.2| 382|Caenorhabditis elegans Hypothetical protein W02B12.1 protein. Length = 382 Score = 27.1 bits (57), Expect = 4.8 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +2 Query: 290 CHERQTFNCDGFSNRSFVSDDNQ 358 C TF CD SN+ F DD Q Sbjct: 236 CEGLHTFECDCESNKQFTDDDIQ 258 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,614,107 Number of Sequences: 27780 Number of extensions: 177170 Number of successful extensions: 440 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 435 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 440 length of database: 12,740,198 effective HSP length: 74 effective length of database: 10,684,478 effective search space used: 598330768 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -