BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30479 (392 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 22 2.2 DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 21 5.1 AB201717-1|BAD90662.1| 107|Apis mellifera apime-corazonin prepr... 21 5.1 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 21 6.7 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 20 8.8 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 22.2 bits (45), Expect = 2.2 Identities = 6/21 (28%), Positives = 11/21 (52%) Frame = -3 Query: 321 PSQLNVWRSWQHPNFIHSVQQ 259 P+ WR W+ PN + + + Sbjct: 856 PAVYEDWRHWKFPNLVEVLDE 876 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 21.0 bits (42), Expect = 5.1 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +2 Query: 287 CCHERQTFNCDGFSNRSFVSDDN 355 CC R + G SNRS S ++ Sbjct: 88 CCGMRWPGDATGLSNRSSTSSND 110 >AB201717-1|BAD90662.1| 107|Apis mellifera apime-corazonin preprohormone protein. Length = 107 Score = 21.0 bits (42), Expect = 5.1 Identities = 9/38 (23%), Positives = 18/38 (47%) Frame = +2 Query: 242 TCAIYFCCTECIKFGCCHERQTFNCDGFSNRSFVSDDN 355 T I C T G + +++ + + +NR+ + DN Sbjct: 15 TITIVMCQTFTYSHGWTNGKRSTSLEELANRNAIQSDN 52 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 20.6 bits (41), Expect = 6.7 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +2 Query: 317 DGFSNRSFVSDDNQ 358 DG+S R VSD N+ Sbjct: 376 DGWSARGLVSDGNE 389 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 20.2 bits (40), Expect = 8.8 Identities = 5/9 (55%), Positives = 8/9 (88%) Frame = -2 Query: 118 LNESWWNIK 92 +N+ WWN+K Sbjct: 363 MNKWWWNMK 371 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 102,437 Number of Sequences: 438 Number of extensions: 2039 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 9638226 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -