BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30476 (725 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_27983| Best HMM Match : PAN (HMM E-Value=0.0022) 34 0.13 SB_59432| Best HMM Match : MORN (HMM E-Value=9.3e-26) 33 0.31 SB_30104| Best HMM Match : Exo_endo_phos (HMM E-Value=0.042) 29 3.8 SB_51387| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.1 SB_32173| Best HMM Match : 7tm_1 (HMM E-Value=7.3e-34) 29 5.1 SB_30500| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_24575| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 >SB_27983| Best HMM Match : PAN (HMM E-Value=0.0022) Length = 616 Score = 33.9 bits (74), Expect = 0.13 Identities = 19/71 (26%), Positives = 37/71 (52%) Frame = +2 Query: 191 SYHVVPVAAHHGAPTIHAAPVPCITMNTRQYIMETSLNMKIMMLIPNMHLNTKSKTLTLG 370 ++HVV + A+ TI A V +T+ +++ N+ ++++ N+H+ T T+ Sbjct: 280 NFHVVTIRANLHEVTIRA-DVHVVTIRGNLHVVTIRANLHVVIIRANLHVVTIRANSTVP 338 Query: 371 T*RANTRLATV 403 RAN L T+ Sbjct: 339 IIRANLHLVTI 349 >SB_59432| Best HMM Match : MORN (HMM E-Value=9.3e-26) Length = 1362 Score = 32.7 bits (71), Expect = 0.31 Identities = 21/69 (30%), Positives = 36/69 (52%), Gaps = 3/69 (4%) Frame = +1 Query: 301 QYEDYDAHPKYAFEYKIEDPHTGDLKSQH---ETRDGDVVKGYYSLHEADGSIRVVEYSA 471 +YE +H K + K++ H GD + H TR G V Y ++ + S+ + E+SA Sbjct: 1185 RYEGEWSHGKISGFGKMKYMH-GDTYTGHWRDNTRHGHGVMSYGAMSSSAASVYIGEWSA 1243 Query: 472 DKHNGFNAV 498 D+ NG+ + Sbjct: 1244 DRKNGYGTM 1252 >SB_30104| Best HMM Match : Exo_endo_phos (HMM E-Value=0.042) Length = 267 Score = 29.1 bits (62), Expect = 3.8 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = -2 Query: 319 HHNLHIEAGLHDVLARVHGDARHGCSVYSRSSMMRCYW 206 +H L ++AGL ++ R HG R + S M+C W Sbjct: 134 NHPLKVQAGLDEIFTRAHG--RPARTFPCGDSFMKCSW 169 >SB_51387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 28.7 bits (61), Expect = 5.1 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +1 Query: 304 YEDYDAHPKYAFEYKIEDPHTGDLKSQHE 390 Y+ YD + KY F +K DP+ D+ E Sbjct: 140 YDKYDKYDKYDFPWKAIDPNLPDMPEDKE 168 >SB_32173| Best HMM Match : 7tm_1 (HMM E-Value=7.3e-34) Length = 375 Score = 28.7 bits (61), Expect = 5.1 Identities = 15/49 (30%), Positives = 24/49 (48%) Frame = -3 Query: 390 LVLALQVPSVRVFDFVFKCIFGMSIIIFILRLVSMMYWRVFMVMHGTGA 244 L+ A V + R+ K I G+++ ++ LVS+ W M TGA Sbjct: 53 LIFAAYVVNARLRSITNKLILGLAVSDMLVGLVSIPLWVYISTMEFTGA 101 >SB_30500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2014 Score = 27.9 bits (59), Expect = 8.9 Identities = 13/45 (28%), Positives = 19/45 (42%) Frame = +1 Query: 412 KGYYSLHEADGSIRVVEYSADKHNGFNAVVKHMLRQSMPSLYNST 546 KG Y H+ DG R +EY + G+ P++Y T Sbjct: 1742 KGSYDTHDVDGRRRTIEYYSGTPQGYLPPAHTRPYPVQPNIYRLT 1786 >SB_24575| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1741 Score = 27.9 bits (59), Expect = 8.9 Identities = 16/58 (27%), Positives = 27/58 (46%), Gaps = 4/58 (6%) Frame = +2 Query: 200 VVPVAAHHGAPTIHAAPVPCITMNTRQYIME----TSLNMKIMMLIPNMHLNTKSKTL 361 V PVAA A + P P + + Y+M +L ++ + MH+ +K K+L Sbjct: 96 VFPVAAPRQAIVVFECPAPTVVLGDILYLMSAVTFAALICFVINFVMKMHIQSKVKSL 153 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,898,250 Number of Sequences: 59808 Number of extensions: 467753 Number of successful extensions: 1081 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 948 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1069 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1937927537 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -