BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30473 (702 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 25 3.0 X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. 24 5.3 CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 23 7.0 AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein p... 23 7.0 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 24.6 bits (51), Expect = 3.0 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = -3 Query: 619 VKVRRYVDVLLRKVKLRASVRRSTNVRA 536 V + R +D + K+ ++SVRR+TN A Sbjct: 2625 VTILRRLDKVFLKISKKSSVRRNTNWEA 2652 >X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. Length = 1231 Score = 23.8 bits (49), Expect = 5.3 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = +2 Query: 335 LPARTLHNRRQTLLQIR-SEGIT 400 +PAR+LHN Q L+Q E IT Sbjct: 939 VPARSLHNHIQKLMQTEPHENIT 961 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 23.4 bits (48), Expect = 7.0 Identities = 15/49 (30%), Positives = 21/49 (42%) Frame = +2 Query: 245 ETRHRRDEFSLRRGVPASGLCGDSGREHAVLPARTLHNRRQTLLQIRSE 391 + R + FS G PA G++ T H R QTL +R+E Sbjct: 1010 QRREHSNSFSYNYGSPAFPTAGENAYS-------TTHRRSQTLSPVRNE 1051 >AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein protein. Length = 724 Score = 23.4 bits (48), Expect = 7.0 Identities = 12/37 (32%), Positives = 17/37 (45%) Frame = +1 Query: 412 LHDSRQSQHHDIVKQTLQTHSVRFQREMVRH*NRRQE 522 L RQ Q H +Q Q + QR+ R +RQ+ Sbjct: 302 LRQQRQQQQHQQQQQQQQQQRQQQQRQQQRQQQQRQQ 338 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 736,278 Number of Sequences: 2352 Number of extensions: 15104 Number of successful extensions: 36 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 36 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 36 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71504505 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -