BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30471 (723 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_0111 - 857627-857975,858123-858334,858428-858550,858662-85... 31 1.2 12_01_0496 + 3939731-3939758,3940459-3942773 29 3.7 >12_01_0111 - 857627-857975,858123-858334,858428-858550,858662-858856, 859259-859498 Length = 372 Score = 30.7 bits (66), Expect = 1.2 Identities = 14/53 (26%), Positives = 28/53 (52%) Frame = +2 Query: 383 IRWAVSSSIHLSYKKKFFSFPTLTVFRRVFQK*LAVYMWTLQLSSIKDVPSYL 541 +RW + + L+ + FFS PT+ + + F + + + T+ + KD P+ L Sbjct: 114 VRWGKEAGLDLTSEDDFFSDPTIKSYYKAFVEAVVTRINTVTNETYKDDPTIL 166 >12_01_0496 + 3939731-3939758,3940459-3942773 Length = 780 Score = 29.1 bits (62), Expect = 3.7 Identities = 13/40 (32%), Positives = 23/40 (57%), Gaps = 2/40 (5%) Frame = -3 Query: 601 KINKCVFRESVTFYLSPWRVEVRRNIF--YRGQLKCPHVN 488 K+ K + ++ TFY S W +E++R + Y G L+ +N Sbjct: 214 KLGKFMASDNTTFYASDWGLEIKRRLTLDYDGNLRLYSLN 253 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,271,199 Number of Sequences: 37544 Number of extensions: 387644 Number of successful extensions: 720 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 703 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 720 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1886372480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -