BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30471 (723 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY748830-1|AAV28178.1| 95|Anopheles gambiae cytochrome P450 pr... 24 4.1 AY748829-1|AAV28177.1| 105|Anopheles gambiae cytochrome P450 pr... 24 5.5 DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 23 9.6 >AY748830-1|AAV28178.1| 95|Anopheles gambiae cytochrome P450 protein. Length = 95 Score = 24.2 bits (50), Expect = 4.1 Identities = 13/35 (37%), Positives = 19/35 (54%), Gaps = 2/35 (5%) Frame = -2 Query: 305 QYSYNSPPFEPKRITASGRNRRGGGTY-PCGL-PR 207 QY N F+P+R + R++ TY P G+ PR Sbjct: 56 QYYPNPSKFDPERFSVENRDKINPNTYLPFGIGPR 90 >AY748829-1|AAV28177.1| 105|Anopheles gambiae cytochrome P450 protein. Length = 105 Score = 23.8 bits (49), Expect = 5.5 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -2 Query: 281 FEPKRITASGRNRRGGGTY 225 F+P+R +A+ RN GTY Sbjct: 70 FDPERFSAANRNNIQPGTY 88 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 23.0 bits (47), Expect = 9.6 Identities = 8/23 (34%), Positives = 11/23 (47%) Frame = -1 Query: 261 CFRQK*ARWWYLPMRTPKRSYHQ 193 C+ W+ LP + SYHQ Sbjct: 152 CYGSPPVPWYQLPQQQQPSSYHQ 174 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 770,976 Number of Sequences: 2352 Number of extensions: 15369 Number of successful extensions: 22 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 73597131 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -