BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30469 (500 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g61170.1 68418.m07674 40S ribosomal protein S19 (RPS19C) 40S ... 98 3e-21 At5g15520.1 68418.m01817 40S ribosomal protein S19 (RPS19B) 40S ... 97 4e-21 At3g02080.1 68416.m00173 40S ribosomal protein S19 (RPS19A) simi... 97 8e-21 At2g02480.1 68415.m00187 DNA polymerase-related weak similarity ... 30 0.76 At4g16095.1 68417.m02440 disease resistance protein-related cont... 29 1.3 At5g45800.1 68418.m05632 leucine-rich repeat transmembrane prote... 29 1.8 At1g14300.1 68414.m01695 expressed protein contains Pfam PF04063... 29 2.3 At5g16500.1 68418.m01928 protein kinase family protein contains ... 27 7.1 At4g37360.1 68417.m05291 cytochrome P450 family protein cytochro... 27 9.4 At2g25280.1 68415.m03024 expressed protein 27 9.4 At1g43620.2 68414.m05008 UDP-glucose:sterol glucosyltransferase,... 27 9.4 At1g43620.1 68414.m05007 UDP-glucose:sterol glucosyltransferase,... 27 9.4 >At5g61170.1 68418.m07674 40S ribosomal protein S19 (RPS19C) 40S ribsomal protein S19, Oryza sativa, SWISSPROT:RS19_ORYSA Length = 143 Score = 97.9 bits (233), Expect = 3e-21 Identities = 40/78 (51%), Positives = 58/78 (74%) Frame = +1 Query: 25 TVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYDPDWFYVRCAAILRHI 204 TVKDV + VK AAHLK++GK+++P D+VKT + KELAPYDPDW+Y+R A++ R + Sbjct: 6 TVKDVSPHEFVKAYAAHLKRSGKIELPLWTDIVKTGKLKELAPYDPDWYYIRAASMARKV 65 Query: 205 YIRSPVGVKTVTKIFGGA 258 Y+R +GV +I+GG+ Sbjct: 66 YLRGGLGVGAFRRIYGGS 83 Score = 62.9 bits (146), Expect = 1e-10 Identities = 26/52 (50%), Positives = 37/52 (71%) Frame = +3 Query: 258 KRNGVTPSHFCRSSGSIARKALQSLEALKLVEKVQDGGRILTTQGRRDLDRI 413 KRNG P HFC+SSG +AR LQ L+ + +V+ GGR +T+ G+RDLD++ Sbjct: 84 KRNGSRPPHFCKSSGGVARHILQQLQTMNIVDLDTKGGRKITSSGQRDLDQV 135 >At5g15520.1 68418.m01817 40S ribosomal protein S19 (RPS19B) 40S RIBOSOMAL PROTEIN S19 - Oryza sativa, SWISSPROT:RS19_ORYSA Length = 143 Score = 97.5 bits (232), Expect = 4e-21 Identities = 41/78 (52%), Positives = 57/78 (73%) Frame = +1 Query: 25 TVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYDPDWFYVRCAAILRHI 204 TVKDV VK A+HLK++GK+++P D+VKT R KELAPYDPDW+Y+R A++ R I Sbjct: 6 TVKDVSPHDFVKAYASHLKRSGKIELPLWTDIVKTGRLKELAPYDPDWYYIRAASMARKI 65 Query: 205 YIRSPVGVKTVTKIFGGA 258 Y+R +GV +I+GG+ Sbjct: 66 YLRGGLGVGAFRRIYGGS 83 Score = 65.7 bits (153), Expect = 2e-11 Identities = 29/52 (55%), Positives = 37/52 (71%) Frame = +3 Query: 258 KRNGVTPSHFCRSSGSIARKALQSLEALKLVEKVQDGGRILTTQGRRDLDRI 413 KRNG P HFC+SSG IAR LQ LE + +VE GGR +T+ G+RDLD++ Sbjct: 84 KRNGSRPPHFCKSSGGIARHILQQLETMSIVELDTKGGRRITSSGQRDLDQV 135 >At3g02080.1 68416.m00173 40S ribosomal protein S19 (RPS19A) similar to 40S ribosomal protein S19 GB:P40978 [Oryza sativa] Length = 143 Score = 96.7 bits (230), Expect = 8e-21 Identities = 39/78 (50%), Positives = 57/78 (73%) Frame = +1 Query: 25 TVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYDPDWFYVRCAAILRHI 204 TVKDV VK A+HLK++GK+++P D+VKT + KELAPYDPDW+Y+R A++ R + Sbjct: 6 TVKDVSPHDFVKAYASHLKRSGKIELPTWTDIVKTGKLKELAPYDPDWYYIRAASMARKV 65 Query: 205 YIRSPVGVKTVTKIFGGA 258 Y+R +GV +I+GG+ Sbjct: 66 YLRGGLGVGAFRRIYGGS 83 Score = 65.7 bits (153), Expect = 2e-11 Identities = 29/52 (55%), Positives = 37/52 (71%) Frame = +3 Query: 258 KRNGVTPSHFCRSSGSIARKALQSLEALKLVEKVQDGGRILTTQGRRDLDRI 413 KRNG P HFC+SSG IAR LQ LE + +VE GGR +T+ G+RDLD++ Sbjct: 84 KRNGSRPPHFCKSSGGIARHILQQLETMNIVELDTKGGRRITSSGQRDLDQV 135 >At2g02480.1 68415.m00187 DNA polymerase-related weak similarity to DNA polymerase III holoenzyme tau subunit [Thermus thermophilus] GI:2583049 Length = 1218 Score = 30.3 bits (65), Expect = 0.76 Identities = 18/61 (29%), Positives = 30/61 (49%), Gaps = 1/61 (1%) Frame = -2 Query: 409 LSRSRLPCVVRMRXXXXXXXXXFNASNDCKALRAILPDDLQKCEGVTPLRLR-HQRSW*Q 233 +S SRL C+ + + NA +D +DL+K G +PL L+ Q++W + Sbjct: 178 ISSSRLDCLSKYQPRDDIVARNCNAGSDDTEEELSNSEDLRKVTGASPLLLKLKQKNWSR 237 Query: 232 S 230 S Sbjct: 238 S 238 >At4g16095.1 68417.m02440 disease resistance protein-related contains weak similarity to rpp8 [Arabidopsis thaliana] gi|3901294|gb|AAC78631 Length = 187 Score = 29.5 bits (63), Expect = 1.3 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = -3 Query: 369 HRPELSQQASMPPTIAKPCVQYCLM 295 H P L Q PP + C++YC M Sbjct: 86 HMPRLPDQHRFPPNLTNICLRYCCM 110 >At5g45800.1 68418.m05632 leucine-rich repeat transmembrane protein kinase, putative Length = 666 Score = 29.1 bits (62), Expect = 1.8 Identities = 12/50 (24%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Frame = +1 Query: 70 AHLKKTGKVKVPEHMDLVK-TARFKELAPYDPDWFYVRCAAILRHIYIRS 216 +H + V P D + T F+ ++ ++ WF C+A++ H+ + S Sbjct: 15 SHSDSSSTVSCPNGTDFHQLTTVFRYVSGFNSSWFSSNCSAVITHVVLPS 64 >At1g14300.1 68414.m01695 expressed protein contains Pfam PF04063: Domain of unknown function (DUF383) and PF04064: Domain of unknown function (DUF384) Length = 339 Score = 28.7 bits (61), Expect = 2.3 Identities = 15/44 (34%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = +3 Query: 285 FCRSSGSIARKALQSLEALKL-VEKVQDGGRILTTQGRRDLDRI 413 FCRSSG A + + ++ + + K +DG ++L RR L +I Sbjct: 143 FCRSSGETADDQFEHVGSILVNISKTEDGRKLLLEPKRRLLKQI 186 >At5g16500.1 68418.m01928 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 636 Score = 27.1 bits (57), Expect = 7.1 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = +1 Query: 34 DVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELA 150 +VE D+ V A K+T + + E VKT F+ELA Sbjct: 30 NVEHDEFRPPVVATTKRTEEREPAEQQPPVKTFNFRELA 68 >At4g37360.1 68417.m05291 cytochrome P450 family protein cytochrome P450 monooxygenase, Arabidopsis thaliana, PID:d1029478 Length = 499 Score = 26.6 bits (56), Expect = 9.4 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = +1 Query: 280 HISAGHQAVLHARLCNRWRH*SLLRKFRTVVAFSPHKVD 396 HIS G+ V+ A WR+ LR+ + FS H+++ Sbjct: 108 HISYGNSTVVSASYSEHWRN---LRRIGALEIFSAHRLN 143 >At2g25280.1 68415.m03024 expressed protein Length = 291 Score = 26.6 bits (56), Expect = 9.4 Identities = 19/64 (29%), Positives = 34/64 (53%), Gaps = 1/64 (1%) Frame = -3 Query: 192 DGSTTHIEPIRVIRSQLFEASCLYKIHVLRYLDFAR-FF*VSSDSFNNLVLFNILYCDGT 16 +G+ + PI ++ + E +Y + +Y+D + FF VSSD + FN ++ D T Sbjct: 143 EGNNVKVVPI-LVGAVSPENEAMYGELLAKYVDDPKNFFSVSSDFCHWGSRFNYMHYDNT 201 Query: 15 HLAL 4 H A+ Sbjct: 202 HGAI 205 >At1g43620.2 68414.m05008 UDP-glucose:sterol glucosyltransferase, putative similar to UDP-glucose:sterol glucosyltransferase [Arabidopsis thaliana] GI:2462931; contains Pfam profile: PF03033 glycosyltransferase family 28 N-terminal domain Length = 615 Score = 26.6 bits (56), Expect = 9.4 Identities = 20/59 (33%), Positives = 30/59 (50%) Frame = +1 Query: 25 TVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYDPDWFYVRCAAILRH 201 T+KD EQ IV L +VPE++ LV E P+D W + +C+A++ H Sbjct: 433 TLKDTEQRGIVDRGWGGLGNLA-TEVPENVFLV------EDCPHD--WLFPQCSAVVHH 482 >At1g43620.1 68414.m05007 UDP-glucose:sterol glucosyltransferase, putative similar to UDP-glucose:sterol glucosyltransferase [Arabidopsis thaliana] GI:2462931; contains Pfam profile: PF03033 glycosyltransferase family 28 N-terminal domain Length = 615 Score = 26.6 bits (56), Expect = 9.4 Identities = 20/59 (33%), Positives = 30/59 (50%) Frame = +1 Query: 25 TVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYDPDWFYVRCAAILRH 201 T+KD EQ IV L +VPE++ LV E P+D W + +C+A++ H Sbjct: 433 TLKDTEQRGIVDRGWGGLGNLA-TEVPENVFLV------EDCPHD--WLFPQCSAVVHH 482 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,395,969 Number of Sequences: 28952 Number of extensions: 202907 Number of successful extensions: 480 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 471 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 480 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 888318720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -