Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30463
         (748 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292382-1|CAL23194.2|  670|Tribolium castaneum gustatory recept...    23   3.4  
EF592539-1|ABQ95985.1|  630|Tribolium castaneum beta-N-acetylglu...    22   4.5  
AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ...    22   4.5  
AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ...    22   4.5  
AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ...    22   4.5  
AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ...    22   4.5  

>AM292382-1|CAL23194.2|  670|Tribolium castaneum gustatory receptor
           candidate 61 protein.
          Length = 670

 Score = 22.6 bits (46), Expect = 3.4
 Identities = 11/36 (30%), Positives = 19/36 (52%)
 Frame = +1

Query: 382 KTNAETKDKSAENASAKKIVLNRPSSISLVSSKTVD 489
           KT  +T +   EN  AKK+++ +    S    +T+D
Sbjct: 198 KTRFKTINNILENLWAKKLIVVKDKKKSRSDEQTID 233


>EF592539-1|ABQ95985.1|  630|Tribolium castaneum
           beta-N-acetylglucosaminidase FDL protein.
          Length = 630

 Score = 22.2 bits (45), Expect = 4.5
 Identities = 11/34 (32%), Positives = 16/34 (47%)
 Frame = -1

Query: 385 FCVLMFVLILFLQRLSQ*KTVPKELNLRLKCPRQ 284
           FC ++F + L+ Q+ S   T       R   PRQ
Sbjct: 15  FCCILFFIYLYWQQTSNLTTSKLLYTYRQPYPRQ 48


>AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase
           variant 2 protein.
          Length = 1558

 Score = 22.2 bits (45), Expect = 4.5
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 388 WFCVLMFVLILFL 350
           W C+L FV +LF+
Sbjct: 305 WKCLLFFVSVLFI 317


>AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase
           variant 1 protein.
          Length = 1558

 Score = 22.2 bits (45), Expect = 4.5
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 388 WFCVLMFVLILFL 350
           W C+L FV +LF+
Sbjct: 305 WKCLLFFVSVLFI 317


>AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase
           CHS1B protein.
          Length = 1558

 Score = 22.2 bits (45), Expect = 4.5
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 388 WFCVLMFVLILFL 350
           W C+L FV +LF+
Sbjct: 305 WKCLLFFVSVLFI 317


>AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase
           CHS1A protein.
          Length = 1558

 Score = 22.2 bits (45), Expect = 4.5
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 388 WFCVLMFVLILFL 350
           W C+L FV +LF+
Sbjct: 305 WKCLLFFVSVLFI 317


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 139,861
Number of Sequences: 336
Number of extensions: 2484
Number of successful extensions: 8
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8
length of database: 122,585
effective HSP length: 56
effective length of database: 103,769
effective search space used: 19923648
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)