BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30463 (748 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 23 3.4 EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglu... 22 4.5 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 22 4.5 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 22 4.5 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 22 4.5 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 22 4.5 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 22.6 bits (46), Expect = 3.4 Identities = 11/36 (30%), Positives = 19/36 (52%) Frame = +1 Query: 382 KTNAETKDKSAENASAKKIVLNRPSSISLVSSKTVD 489 KT +T + EN AKK+++ + S +T+D Sbjct: 198 KTRFKTINNILENLWAKKLIVVKDKKKSRSDEQTID 233 >EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglucosaminidase FDL protein. Length = 630 Score = 22.2 bits (45), Expect = 4.5 Identities = 11/34 (32%), Positives = 16/34 (47%) Frame = -1 Query: 385 FCVLMFVLILFLQRLSQ*KTVPKELNLRLKCPRQ 284 FC ++F + L+ Q+ S T R PRQ Sbjct: 15 FCCILFFIYLYWQQTSNLTTSKLLYTYRQPYPRQ 48 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 22.2 bits (45), Expect = 4.5 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 388 WFCVLMFVLILFL 350 W C+L FV +LF+ Sbjct: 305 WKCLLFFVSVLFI 317 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 22.2 bits (45), Expect = 4.5 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 388 WFCVLMFVLILFL 350 W C+L FV +LF+ Sbjct: 305 WKCLLFFVSVLFI 317 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 22.2 bits (45), Expect = 4.5 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 388 WFCVLMFVLILFL 350 W C+L FV +LF+ Sbjct: 305 WKCLLFFVSVLFI 317 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 22.2 bits (45), Expect = 4.5 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 388 WFCVLMFVLILFL 350 W C+L FV +LF+ Sbjct: 305 WKCLLFFVSVLFI 317 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 139,861 Number of Sequences: 336 Number of extensions: 2484 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 19923648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -