SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30463
         (748 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CR954257-4|CAJ14155.1|  196|Anopheles gambiae predicted protein ...    24   5.7  

>CR954257-4|CAJ14155.1|  196|Anopheles gambiae predicted protein
           protein.
          Length = 196

 Score = 23.8 bits (49), Expect = 5.7
 Identities = 12/36 (33%), Positives = 18/36 (50%)
 Frame = +1

Query: 373 LKRKTNAETKDKSAENASAKKIVLNRPSSISLVSSK 480
           L   TNA+TK  S+ N +    +   P+  S + SK
Sbjct: 20  LPANTNAQTKQDSSNNNNRTTELFAYPAEQSAIESK 55


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 600,413
Number of Sequences: 2352
Number of extensions: 9518
Number of successful extensions: 16
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 14
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 16
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 76923555
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -