BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30460 (788 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 27 0.87 AY193729-1|AAO62002.1| 499|Anopheles gambiae cytochrome P450 CY... 25 3.5 AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. 24 4.7 AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 23 8.1 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 26.6 bits (56), Expect = 0.87 Identities = 14/39 (35%), Positives = 23/39 (58%), Gaps = 1/39 (2%) Frame = -1 Query: 200 YSETRSFMLLSASVNSISSMPSPVYQCKKALR-LNIAVN 87 + +TR+ +L S N+I S+P ++ LR LNI+ N Sbjct: 167 FGQTRNLEVLDLSTNNIWSLPDHLFCSLSGLRSLNISSN 205 >AY193729-1|AAO62002.1| 499|Anopheles gambiae cytochrome P450 CYPm3r9 protein. Length = 499 Score = 24.6 bits (51), Expect = 3.5 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -3 Query: 486 VKEKHRECKHNLLPRHN 436 V+EK REC +L +HN Sbjct: 326 VQEKGRECVREILQKHN 342 >AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. Length = 1133 Score = 24.2 bits (50), Expect = 4.7 Identities = 9/30 (30%), Positives = 20/30 (66%) Frame = -3 Query: 531 RVAVYCNNIPELPFVVKEKHRECKHNLLPR 442 ++AVY N+P L +++ H++ + + +PR Sbjct: 514 KLAVYGTNMPALVARIRQLHQQGQFSEMPR 543 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 23.4 bits (48), Expect = 8.1 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = -2 Query: 151 SRPCPRRCTNARKP 110 + PC R CT RKP Sbjct: 286 NHPCKRACTLGRKP 299 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 751,661 Number of Sequences: 2352 Number of extensions: 15497 Number of successful extensions: 40 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 40 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 40 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 82744797 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -