BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30451 (880 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g53350.1 68414.m06048 disease resistance protein (CC-NBS-LRR ... 29 5.4 At5g10660.1 68418.m01234 calmodulin-binding protein-related cont... 28 9.5 >At1g53350.1 68414.m06048 disease resistance protein (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. Length = 906 Score = 28.7 bits (61), Expect = 5.4 Identities = 13/44 (29%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = -1 Query: 292 DSAMPCTRCMRQTRCGRTEQIHFVVRYVVAGDRSSIENLQR-WT 164 + +MPC R + C + +Q+ ++YV IE ++R WT Sbjct: 837 EGSMPCLRTLTIDNCKKLKQLPDGLKYVTCLKELKIERMKREWT 880 >At5g10660.1 68418.m01234 calmodulin-binding protein-related contains weak similarity to calmodulin-binding proteins Length = 407 Score = 27.9 bits (59), Expect = 9.5 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = +2 Query: 107 PESSITYSSYKSAERSLDSSPSLKILNRRP 196 P SS+T S SA RSL++SP+ L +P Sbjct: 90 PPSSLTSPSTSSAHRSLNTSPAHPHLRDKP 119 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,199,949 Number of Sequences: 28952 Number of extensions: 358560 Number of successful extensions: 1014 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 984 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1014 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 2067932800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -