BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30447 (892 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY313948-1|AAP76391.1| 424|Anopheles gambiae cytochrome P450 CY... 29 0.25 AY193730-1|AAO62003.1| 441|Anopheles gambiae cytochrome P450 CY... 27 1.0 AY193729-1|AAO62002.1| 499|Anopheles gambiae cytochrome P450 CY... 26 1.3 Z69976-1|CAA93816.1| 204|Anopheles gambiae ribosomal protein RL... 25 2.3 AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subu... 23 9.4 >AY313948-1|AAP76391.1| 424|Anopheles gambiae cytochrome P450 CYP6M4 protein. Length = 424 Score = 28.7 bits (61), Expect = 0.25 Identities = 11/17 (64%), Positives = 15/17 (88%) Frame = -1 Query: 352 VPGSTFLLEAGTGVVVP 302 VPG+T +LEAGT V++P Sbjct: 323 VPGTTSVLEAGTSVMIP 339 >AY193730-1|AAO62003.1| 441|Anopheles gambiae cytochrome P450 CYPm3r10 protein. Length = 441 Score = 26.6 bits (56), Expect = 1.0 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = -1 Query: 352 VPGSTFLLEAGTGVVVP 302 VPG+ +LEAGT V+VP Sbjct: 323 VPGTKTVLEAGTSVMVP 339 >AY193729-1|AAO62002.1| 499|Anopheles gambiae cytochrome P450 CYPm3r9 protein. Length = 499 Score = 26.2 bits (55), Expect = 1.3 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = -1 Query: 352 VPGSTFLLEAGTGVVVP 302 VPG+ +LEAGT V++P Sbjct: 383 VPGTKSVLEAGTAVMIP 399 >Z69976-1|CAA93816.1| 204|Anopheles gambiae ribosomal protein RL10 protein. Length = 204 Score = 25.4 bits (53), Expect = 2.3 Identities = 15/52 (28%), Positives = 22/52 (42%) Frame = +3 Query: 246 RSSRLPWGLCRSSHGRQELGTTTPVPASSRNVDPGTQSCHLDGNGRRATRLR 401 R + W +C + H +EL T SSR + + G RRA +R Sbjct: 144 RDPNVNW-ICNAVHKHRELRGLTSAGKSSRGLGKAYRYSQTIGGSRRAAGVR 194 >AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subunit protein. Length = 837 Score = 23.4 bits (48), Expect = 9.4 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +3 Query: 339 VDPGTQSCHLDGNGR 383 + P CHLD NGR Sbjct: 322 ITPNDGECHLDHNGR 336 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 877,064 Number of Sequences: 2352 Number of extensions: 19583 Number of successful extensions: 41 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 37 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 41 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 95920632 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -