BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30441 (808 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 24 1.6 EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 ... 23 2.2 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 23 2.2 AJ850297-1|CAH64517.1| 539|Tribolium castaneum putative esteras... 22 6.6 AJ850295-1|CAH64515.1| 539|Tribolium castaneum putative esteras... 22 6.6 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 23.8 bits (49), Expect = 1.6 Identities = 14/47 (29%), Positives = 24/47 (51%) Frame = -3 Query: 314 FQRVRD*FNDTVRMRGSERYRSERVLNE*NSYGLPRDRLKSTTNGSR 174 F RV+D F + V +R + + V + + YGL + + +GSR Sbjct: 579 FDRVKDLFLEAVLLRYPDLNKIFYVQTDSSGYGLGAELYQIQEDGSR 625 >EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 protein. Length = 493 Score = 23.4 bits (48), Expect = 2.2 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = -2 Query: 789 VRIATVLNQFPLTSTDQA*FTIFRVPAFVLRARLSFTD 676 +++AT L F + F+ F +P+FV RL+F D Sbjct: 198 LKMATQLVDFKSVIRSISVFSFFFMPSFVDIFRLTFVD 235 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 23.4 bits (48), Expect = 2.2 Identities = 9/28 (32%), Positives = 12/28 (42%) Frame = -3 Query: 725 SFGSQHLCSERAFHSLIGNETPRECENH 642 + G +HL R H + CENH Sbjct: 602 ALGMEHLAKTRVVHRDLAARNVLVCENH 629 >AJ850297-1|CAH64517.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 21.8 bits (44), Expect = 6.6 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = +1 Query: 79 DGTFVSCVRSPSARYV 126 DGT + C++S AR + Sbjct: 251 DGTMIKCLKSRPARQI 266 >AJ850295-1|CAH64515.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 21.8 bits (44), Expect = 6.6 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = +1 Query: 79 DGTFVSCVRSPSARYV 126 DGT + C++S AR + Sbjct: 251 DGTMIKCLKSRPARQI 266 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 168,195 Number of Sequences: 336 Number of extensions: 3505 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21999028 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -