BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30441 (808 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_0922 - 33022709-33023545 29 3.3 02_04_0170 + 20576149-20576889 29 4.4 08_01_0519 - 4518256-4519623,4520840-4521230,4521313-4521525,452... 29 5.8 10_01_0087 - 1072279-1072762,1074884-1075020,1075379-1075479,107... 28 7.6 >01_06_0922 - 33022709-33023545 Length = 278 Score = 29.5 bits (63), Expect = 3.3 Identities = 16/41 (39%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = -1 Query: 145 SRDVKRSRTVPTENERTKRTFRQHLN-ARKRTPERKR*ISP 26 SR + S + P E+ R+ R+ + A KRTPE++R SP Sbjct: 159 SRSARASASPPPRREQRDRSVRRSPSPAAKRTPEQRRAASP 199 >02_04_0170 + 20576149-20576889 Length = 246 Score = 29.1 bits (62), Expect = 4.4 Identities = 16/52 (30%), Positives = 27/52 (51%) Frame = -3 Query: 596 FAFTFVTPFSLMLKIYKTQ*LAHMLDSLVLFQDGSCECPKLYHRRRSNKHAL 441 + T VT S+ + ++ T + + L LF+D S +C +LY R + AL Sbjct: 187 YNITAVTSLSMFMFMFYT--IVSTISPLRLFRDSSLQCKRLYMYRSTRMGAL 236 >08_01_0519 - 4518256-4519623,4520840-4521230,4521313-4521525, 4521632-4521723,4522226-4522342,4522641-4522704, 4523175-4523228,4523579-4523666,4523788-4524023, 4525258-4525478,4525634-4525827,4525938-4525995, 4526771-4526824,4526851-4527473,4527580-4527640, 4528417-4528590,4528803-4529063,4529201-4529320, 4529388-4530022,4530062-4530828,4530915-4531012, 4531101-4531155,4531230-4531318 Length = 2010 Score = 28.7 bits (61), Expect = 5.8 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = +2 Query: 344 PARRKSTSYFLVSCLSADASATRLLSQPCSLGLVRVCLNVCD 469 P RRK S L +S LSQ C+ G++ + L++CD Sbjct: 1319 PNRRKGESQELKQINPLHSSHLHALSQACAPGVILMPLDLCD 1360 >10_01_0087 - 1072279-1072762,1074884-1075020,1075379-1075479, 1075581-1075806 Length = 315 Score = 28.3 bits (60), Expect = 7.6 Identities = 16/49 (32%), Positives = 23/49 (46%) Frame = -3 Query: 290 NDTVRMRGSERYRSERVLNE*NSYGLPRDRLKSTTNGSRCITKREVHVF 144 ++ V M G +R ER + +YG DRL+ T S C E +F Sbjct: 240 HNAVAMSGRQRSAMERFRTKYMTYGYCYDRLRYPTPPSECNVGPEAELF 288 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,776,027 Number of Sequences: 37544 Number of extensions: 387433 Number of successful extensions: 925 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 906 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 925 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2197677108 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -