BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30440 (511 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF265297-1|AAG17640.1| 125|Tribolium castaneum putative cytochr... 22 2.8 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 3.7 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 21 6.4 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 21 6.4 AY531876-2|AAT08871.1| 340|Tribolium castaneum tyrosine recombi... 21 8.4 AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle pr... 21 8.4 >AF265297-1|AAG17640.1| 125|Tribolium castaneum putative cytochrome P450 monooxigenase protein. Length = 125 Score = 22.2 bits (45), Expect = 2.8 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = -2 Query: 339 ACPGRSNSNFFVFILQTFSVESALELNSI*NLQTMQPCIQ 220 AC F I +TFS ++ + S+ L+ M+ CI+ Sbjct: 13 ACHPDIQERIFEEIEETFSDDTKPDYKSLQELKYMERCIK 52 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.8 bits (44), Expect = 3.7 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -1 Query: 202 NVVINFPLAASHNFTDLSNEADAIILVSG 116 +V+ F HNF +SN+ ++ I+ G Sbjct: 206 HVIYAFATIDPHNFNMISNDDESDIIQGG 234 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 21.0 bits (42), Expect = 6.4 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = -2 Query: 423 CHNFNTLSFPPDA 385 CHN + LS PP A Sbjct: 128 CHNGDPLSQPPPA 140 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 21.0 bits (42), Expect = 6.4 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = -2 Query: 423 CHNFNTLSFPPDA 385 CHN + LS PP A Sbjct: 20 CHNGDPLSQPPPA 32 >AY531876-2|AAT08871.1| 340|Tribolium castaneum tyrosine recombinase protein. Length = 340 Score = 20.6 bits (41), Expect = 8.4 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +3 Query: 9 SGSDDFTLFLWLPEKEKKPL 68 SG F L LP+ +KKPL Sbjct: 206 SGPHKFQPLLRLPKFKKKPL 225 >AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle protein. Length = 361 Score = 20.6 bits (41), Expect = 8.4 Identities = 7/11 (63%), Positives = 10/11 (90%) Frame = -2 Query: 366 DQSTAYTSSAC 334 DQS+AY +S+C Sbjct: 339 DQSSAYDASSC 349 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 125,606 Number of Sequences: 336 Number of extensions: 2582 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12154132 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -