BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30440 (511 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-12|CAD27763.1| 450|Anopheles gambiae putative tachykin... 24 2.6 AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. 23 4.5 AB090823-1|BAC57921.1| 429|Anopheles gambiae gag-like protein p... 23 4.5 >AJ439060-12|CAD27763.1| 450|Anopheles gambiae putative tachykinin receptor protein. Length = 450 Score = 24.2 bits (50), Expect = 2.6 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -2 Query: 369 GDQSTAYTSSACPGRSNSN 313 G++STA TSS CP + N Sbjct: 14 GNKSTAGTSSCCPAGTGLN 32 >AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. Length = 897 Score = 23.4 bits (48), Expect = 4.5 Identities = 10/38 (26%), Positives = 17/38 (44%) Frame = +2 Query: 257 LLSSSADSTLKVWSMKTKKLELDLPGHADEVYAVDWSP 370 L +AD+ VW + +L L D ++ +W P Sbjct: 758 LKQCTADTPQIVWFWQVSSTDLQLSMSEDRLHVFNWLP 795 >AB090823-1|BAC57921.1| 429|Anopheles gambiae gag-like protein protein. Length = 429 Score = 23.4 bits (48), Expect = 4.5 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +3 Query: 48 EKEKKPLARMTGHQQLINDVKFSPDTRIIASASFD 152 EK+++P + HQQ+ +P +++ ASFD Sbjct: 99 EKQRQPPQQQ--HQQIGPSTSAAPPQLLVSGASFD 131 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 538,798 Number of Sequences: 2352 Number of extensions: 10483 Number of successful extensions: 16 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46091631 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -