BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30436 (873 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 26 1.3 AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific tran... 26 1.3 AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-s... 26 1.3 U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. 25 4.0 U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. 25 4.0 AF295693-1|AAL55241.1| 786|Anopheles gambiae polyprotein protein. 24 7.0 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 26.2 bits (55), Expect = 1.3 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = +3 Query: 603 ASKHTETSYEWFAHPHHEEHYASSGHGWG 689 +S+H + +++ H HH +H G G G Sbjct: 272 SSQHQQPTHQTHHHHHHHQHGGGVGGGGG 300 >AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific transcription factor FRU-MB protein. Length = 759 Score = 26.2 bits (55), Expect = 1.3 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = +3 Query: 603 ASKHTETSYEWFAHPHHEEHYASSGHGWG 689 +S+H + +++ H HH +H G G G Sbjct: 272 SSQHQQPTHQTHHHHHHHQHGGGVGGGGG 300 >AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-specific zinc-fingerC isoform protein. Length = 593 Score = 26.2 bits (55), Expect = 1.3 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = +3 Query: 603 ASKHTETSYEWFAHPHHEEHYASSGHGWG 689 +S+H + +++ H HH +H G G G Sbjct: 224 SSQHQQPTHQTHHHHHHHQHGGGVGGGGG 252 >U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 24.6 bits (51), Expect = 4.0 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = -2 Query: 80 QQASPTPRRSPLKRPDTSYRPF 15 Q P P+R+ L+R D+ +RP+ Sbjct: 208 QPIVPQPQRASLERRDSLFRPY 229 >U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 24.6 bits (51), Expect = 4.0 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = -2 Query: 80 QQASPTPRRSPLKRPDTSYRPF 15 Q P P+R+ L+R D+ +RP+ Sbjct: 208 QPIVPQPQRASLERRDSLFRPY 229 >AF295693-1|AAL55241.1| 786|Anopheles gambiae polyprotein protein. Length = 786 Score = 23.8 bits (49), Expect = 7.0 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = -1 Query: 411 SPHALNSGRRELELYDVIFQEVCHTVYEPRLDLC 310 SP +G+ E+ D+I +VC + E L C Sbjct: 325 SPFPPVAGKTSTEVLDIIHSDVCGPMEETTLGGC 358 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 825,365 Number of Sequences: 2352 Number of extensions: 16118 Number of successful extensions: 47 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 38 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 47 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 93439926 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -