BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30436 (873 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U40415-10|AAK39254.1| 215|Caenorhabditis elegans Dnaj domain (p... 28 7.6 AC024778-1|AAF60567.1| 393|Caenorhabditis elegans Collagen prot... 28 7.6 >U40415-10|AAK39254.1| 215|Caenorhabditis elegans Dnaj domain (prokaryotic heat shockprotein) protein 14 protein. Length = 215 Score = 28.3 bits (60), Expect = 7.6 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 3/41 (7%) Frame = +2 Query: 74 PAAEQDSDPNI---LGSVLGVVKECVDGDVTLCLKEKALRY 187 PAA+ DP L +VLG+ K D ++ ++ ALRY Sbjct: 25 PAADHSHDPKKGLHLYNVLGIQKNATDDEIKKAYRKLALRY 65 >AC024778-1|AAF60567.1| 393|Caenorhabditis elegans Collagen protein 115 protein. Length = 393 Score = 28.3 bits (60), Expect = 7.6 Identities = 17/33 (51%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = +2 Query: 224 VDGVTLDSK-GYPGLPGPWSHCPRSPRPGKHRS 319 +DG T+D + G PGLPGP P P PG H S Sbjct: 263 LDGETIDGEDGSPGLPGPPG--PPGP-PGLHGS 292 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,126,572 Number of Sequences: 27780 Number of extensions: 359605 Number of successful extensions: 1338 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1130 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1332 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2192413762 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -