BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30435 (875 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_05_0576 + 25765137-25766420 29 3.7 07_03_1188 + 24671022-24672482 29 6.5 06_01_0778 + 5816588-5816885,5817554-5817615,5818764-5818905,581... 29 6.5 05_03_0470 + 14448243-14448482,14448568-14449181,14449508-144501... 29 6.5 04_03_0286 + 13915705-13915984,13916478-13917062,13918188-139186... 29 6.5 04_04_1459 + 33758891-33758954,33759101-33759327,33759916-337599... 28 8.5 02_02_0223 - 8021040-8021247,8022275-8022367,8022808-8023059,802... 28 8.5 >03_05_0576 + 25765137-25766420 Length = 427 Score = 29.5 bits (63), Expect = 3.7 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = -2 Query: 91 ASVCLSPPWQRQPRPTMPP 35 A+V +SPP Q +PRP +PP Sbjct: 97 AAVSVSPPTQPRPRPELPP 115 >07_03_1188 + 24671022-24672482 Length = 486 Score = 28.7 bits (61), Expect = 6.5 Identities = 22/74 (29%), Positives = 30/74 (40%) Frame = -1 Query: 251 ASEIVSFLVTEADTFVPSIAFVTAVAFIATSEIMSSIRSYVIDAPFVLFLLFDCFGVPFS 72 A+E+ FLV A V +A ++RS V + P L D Sbjct: 98 AAELFRFLVRRRSLHPSDSALAPVVRHLARRRDFPAVRSLVQEFPSALG--HDTLDAYLL 155 Query: 71 SLAKATTANDATKI 30 SLA+A A DA K+ Sbjct: 156 SLARAGRATDAVKV 169 >06_01_0778 + 5816588-5816885,5817554-5817615,5818764-5818905, 5819969-5820064,5820147-5820266,5820401-5820663, 5821507-5821617 Length = 363 Score = 28.7 bits (61), Expect = 6.5 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = -1 Query: 395 PSLPPQQF*CARGVHDDRGGSRLRWQL 315 P LPP+ C VH D GG+ +RW L Sbjct: 247 PPLPPE---CNAQVHTDYGGAAVRWGL 270 >05_03_0470 + 14448243-14448482,14448568-14449181,14449508-14450135, 14450217-14450827,14450911-14451162,14451243-14451353, 14451441-14451501,14451603-14451695,14451773-14451940 Length = 925 Score = 28.7 bits (61), Expect = 6.5 Identities = 18/57 (31%), Positives = 30/57 (52%) Frame = +1 Query: 67 KEEKGTPKQSKRRNKTKGASMT*DLMEDIISEVAMKATAVTKAMEGTKVSASVTKKD 237 KE + P++SKR+ K K S D+ + ++ A+TK +G + SV +KD Sbjct: 78 KEGETAPRRSKRQPKKKVPSKDDDVPANTTGTKKIERLAITKKRKGER---SVNRKD 131 >04_03_0286 + 13915705-13915984,13916478-13917062,13918188-13918661, 13918963-13920208,13920282-13920297 Length = 866 Score = 28.7 bits (61), Expect = 6.5 Identities = 11/23 (47%), Positives = 16/23 (69%), Gaps = 1/23 (4%) Frame = +3 Query: 9 DHNE-VHGYFGGIVGRGCLCQGG 74 +H++ + GYF I+G CLC GG Sbjct: 251 EHSKCMDGYFAPILGYNCLCDGG 273 >04_04_1459 + 33758891-33758954,33759101-33759327,33759916-33759966, 33760265-33760313,33760738-33761018 Length = 223 Score = 28.3 bits (60), Expect = 8.5 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +3 Query: 54 GCLCQGGERHTEAVEEKKQDKRG 122 G LC GGE A EEKK+ ++G Sbjct: 143 GGLCVGGELQVRAEEEKKEVRKG 165 >02_02_0223 - 8021040-8021247,8022275-8022367,8022808-8023059, 8023143-8023597,8023667-8023983,8024019-8024298, 8024423-8024728,8024762-8025130,8025216-8025455 Length = 839 Score = 28.3 bits (60), Expect = 8.5 Identities = 19/57 (33%), Positives = 30/57 (52%) Frame = +1 Query: 67 KEEKGTPKQSKRRNKTKGASMT*DLMEDIISEVAMKATAVTKAMEGTKVSASVTKKD 237 KE + TP +SKR+ K K S D+ + + +A+TK +G + SV +KD Sbjct: 78 KEGETTPWRSKRQPKKKVPSKDDDVPANTTGTKNSERSAITKKRKGER---SVNRKD 131 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,534,374 Number of Sequences: 37544 Number of extensions: 424885 Number of successful extensions: 1278 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1218 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1278 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2467979640 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -