BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30435 (875 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z78066-9|CAN86643.1| 2488|Caenorhabditis elegans Hypothetical pr... 29 5.8 Z78066-6|CAB51467.1| 2484|Caenorhabditis elegans Hypothetical pr... 29 5.8 Z78066-4|CAB01522.2| 2607|Caenorhabditis elegans Hypothetical pr... 29 5.8 >Z78066-9|CAN86643.1| 2488|Caenorhabditis elegans Hypothetical protein W06A7.3f protein. Length = 2488 Score = 28.7 bits (61), Expect = 5.8 Identities = 20/65 (30%), Positives = 29/65 (44%), Gaps = 3/65 (4%) Frame = +1 Query: 571 KVPYEVKVHVDKPYESKSKCPLPTPLRRKSLM---K*KCPFPQPYTVREKGPSSSEIRIK 741 +V E ++ P S+S CP+P PL L K P P+P + I ++ Sbjct: 1567 EVVTESEISEMAPQVSESTCPIPEPLADLKLPVEDDEKTPEPEPVVPGQVQERIIPIEVE 1626 Query: 742 GAPTI 756 APTI Sbjct: 1627 QAPTI 1631 >Z78066-6|CAB51467.1| 2484|Caenorhabditis elegans Hypothetical protein W06A7.3c protein. Length = 2484 Score = 28.7 bits (61), Expect = 5.8 Identities = 20/65 (30%), Positives = 29/65 (44%), Gaps = 3/65 (4%) Frame = +1 Query: 571 KVPYEVKVHVDKPYESKSKCPLPTPLRRKSLM---K*KCPFPQPYTVREKGPSSSEIRIK 741 +V E ++ P S+S CP+P PL L K P P+P + I ++ Sbjct: 1567 EVVTESEISEMAPQVSESTCPIPEPLADLKLPVEDDEKTPEPEPVVPGQVQERIIPIEVE 1626 Query: 742 GAPTI 756 APTI Sbjct: 1627 QAPTI 1631 >Z78066-4|CAB01522.2| 2607|Caenorhabditis elegans Hypothetical protein W06A7.3a protein. Length = 2607 Score = 28.7 bits (61), Expect = 5.8 Identities = 20/65 (30%), Positives = 29/65 (44%), Gaps = 3/65 (4%) Frame = +1 Query: 571 KVPYEVKVHVDKPYESKSKCPLPTPLRRKSLM---K*KCPFPQPYTVREKGPSSSEIRIK 741 +V E ++ P S+S CP+P PL L K P P+P + I ++ Sbjct: 1567 EVVTESEISEMAPQVSESTCPIPEPLADLKLPVEDDEKTPEPEPVVPGQVQERIIPIEVE 1626 Query: 742 GAPTI 756 APTI Sbjct: 1627 QAPTI 1631 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,881,051 Number of Sequences: 27780 Number of extensions: 341175 Number of successful extensions: 1108 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1012 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1107 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2202903780 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -