BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30435 (875 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g00890.1 68417.m00120 proline-rich family protein contains pr... 33 0.19 At5g48230.2 68418.m05959 acetyl-CoA C-acyltransferase, putative ... 30 2.3 At5g48230.1 68418.m05958 acetyl-CoA C-acyltransferase, putative ... 30 2.3 At5g18230.1 68418.m02139 transcription regulator NOT2/NOT3/NOT5 ... 30 2.3 At3g44670.1 68416.m04804 disease resistance protein RPP1-Ws[A,C]... 28 9.4 At3g44480.1 68416.m04781 disease resistance protein (TIR-NBS-LRR... 28 9.4 >At4g00890.1 68417.m00120 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 431 Score = 33.5 bits (73), Expect = 0.19 Identities = 20/64 (31%), Positives = 33/64 (51%), Gaps = 2/64 (3%) Frame = +1 Query: 610 YESKSKCPLPTPLRRKSLMK*KCPFPQPYTVREKGPSSSEIRIKGAPTIR-SIKKV-PYE 783 ++SKS P P+P + SL K P P P T+ P S + P+ + S+ ++ P + Sbjct: 278 HQSKSPMPPPSPTAQISLSSLKSPIPSPATITAPPPPFSSPLSQTTPSPKPSLPQIEPNQ 337 Query: 784 VKVP 795 +K P Sbjct: 338 IKSP 341 >At5g48230.2 68418.m05959 acetyl-CoA C-acyltransferase, putative / 3-ketoacyl-CoA thiolase, putative strong similarity to Acetoacetyl-coenzyme A thiolase (E.C. 2.3.1.9) [Raphanus sativus] GI:1542941; contains InterPro accession IPR002155: Thiolase Length = 403 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -2 Query: 484 GLRYGHFHLIGYFLLDGIGDVFLDC 410 G R+GH L+ L DG+ DV+ DC Sbjct: 140 GSRFGHDSLVDGMLKDGLWDVYNDC 164 >At5g48230.1 68418.m05958 acetyl-CoA C-acyltransferase, putative / 3-ketoacyl-CoA thiolase, putative strong similarity to Acetoacetyl-coenzyme A thiolase (E.C. 2.3.1.9) [Raphanus sativus] GI:1542941; contains InterPro accession IPR002155: Thiolase Length = 398 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -2 Query: 484 GLRYGHFHLIGYFLLDGIGDVFLDC 410 G R+GH L+ L DG+ DV+ DC Sbjct: 135 GSRFGHDSLVDGMLKDGLWDVYNDC 159 >At5g18230.1 68418.m02139 transcription regulator NOT2/NOT3/NOT5 family protein contains Pfam domain PF04153: NOT2 / NOT3 / NOT5 family Length = 843 Score = 29.9 bits (64), Expect = 2.3 Identities = 18/58 (31%), Positives = 29/58 (50%) Frame = +1 Query: 58 AFAKEEKGTPKQSKRRNKTKGASMT*DLMEDIISEVAMKATAVTKAMEGTKVSASVTK 231 AF+KE G +Q K K K S T D + +++SE+ + + +EG V T+ Sbjct: 109 AFSKE--GLGQQPKTDPKEKAKSETRDWLNNVVSELESQIDSFEAELEGLSVKKGKTR 164 >At3g44670.1 68416.m04804 disease resistance protein RPP1-Ws[A,C]-like (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Closest Col-0 homolog to both RPP1 Ws-A and RPP1 Ws-C Length = 872 Score = 27.9 bits (59), Expect = 9.4 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = +1 Query: 388 KEGACSVYSRETRPLYRREESTL*GESARTSA 483 K G C + RETR L R L ES+R S+ Sbjct: 787 KIGECGILQRETRSLRRSSSPDLSPESSRVSS 818 >At3g44480.1 68416.m04781 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1194 Score = 27.9 bits (59), Expect = 9.4 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = +1 Query: 388 KEGACSVYSRETRPLYRREESTL*GESARTSA 483 K G C + RETR L R L ES+R S+ Sbjct: 1155 KIGECGILQRETRSLRRSSSPDLSPESSRVSS 1186 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,090,664 Number of Sequences: 28952 Number of extensions: 325506 Number of successful extensions: 1072 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 866 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1072 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 2058178400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -