BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30432 (801 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 26 0.47 DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 22 5.8 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 25.8 bits (54), Expect = 0.47 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -2 Query: 677 YIATCH*FCTKCMCRLGNKYKDLLITLILQL 585 YIA CH F + M +L K +++ +L L Sbjct: 153 YIAICHPFISHTMSKLSRAVKFIIVIWLLAL 183 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 22.2 bits (45), Expect = 5.8 Identities = 7/17 (41%), Positives = 13/17 (76%) Frame = +1 Query: 184 VRYYFRFIKQSGRLNHY 234 V Y+F ++ +S R+N+Y Sbjct: 440 VFYWFAYLSRSERINYY 456 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 202,931 Number of Sequences: 438 Number of extensions: 3960 Number of successful extensions: 19 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25367793 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -