BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30431 (748 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0460 - 8654283-8654302,8654669-8654847,8654940-8655125,865... 30 2.2 08_02_1536 + 27684789-27685517 28 6.9 >03_02_0460 - 8654283-8654302,8654669-8654847,8654940-8655125, 8655626-8655781,8656223-8656431,8657254-8657358 Length = 284 Score = 29.9 bits (64), Expect = 2.2 Identities = 14/47 (29%), Positives = 27/47 (57%) Frame = -2 Query: 591 YYIFNIACYCMIIFHIHFYKHLNLKYLMHVEHNKRNQLIIDITYPSK 451 YYIFN +++FHI+++K + L + + N + Q+ D+ S+ Sbjct: 237 YYIFNTMLLTLLVFHIYWWKLICLMIMKQL--NNKGQVGEDVRSDSE 281 >08_02_1536 + 27684789-27685517 Length = 242 Score = 28.3 bits (60), Expect = 6.9 Identities = 17/63 (26%), Positives = 29/63 (46%), Gaps = 1/63 (1%) Frame = +1 Query: 205 STFFKVCNGFQHYTFLSSCLRMSMSNKVSKTE-CKRNQYINILQNIPKPLVKLYGCIEVT 381 +T +CNGF+ T + SC+ M S+ CK Q + + + + L L C + Sbjct: 37 ATMETMCNGFRRLTDVYSCMDEIMCLPSSQASLCKHQQRREVEKELERSLTLLDLCNAMQ 96 Query: 382 KEF 390 + F Sbjct: 97 ESF 99 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,711,059 Number of Sequences: 37544 Number of extensions: 260990 Number of successful extensions: 454 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 444 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 454 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1980691104 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -