BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30430 (828 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0802 + 23313763-23313835,23314100-23314152,23314651-233147... 44 2e-04 10_01_0133 + 1621574-1625779 29 6.0 >12_02_0802 + 23313763-23313835,23314100-23314152,23314651-23314751, 23315970-23316063 Length = 106 Score = 43.6 bits (98), Expect = 2e-04 Identities = 25/68 (36%), Positives = 37/68 (54%) Frame = +3 Query: 255 QEFTTLPLDIVIQAVVSLFAVMWGVLNVAGNLREIPAAAELNAIKWETQNNLPSFYIFNH 434 +EF++ P+D+++Q ++ L MW L V + +E N I NL F IFNH Sbjct: 34 EEFSSPPMDVMMQLLLGLALCMWAGLAVPAKFLSVLPHSEENRIV-SLPANL-DFMIFNH 91 Query: 435 RGKALSYD 458 RG+AL D Sbjct: 92 RGRALPSD 99 >10_01_0133 + 1621574-1625779 Length = 1401 Score = 28.7 bits (61), Expect = 6.0 Identities = 19/62 (30%), Positives = 29/62 (46%), Gaps = 2/62 (3%) Frame = +1 Query: 121 FILSCY*SVHNMASFHKVIVIIGFLSLFHTAFSATQHRSYLRITSKSLPRYHW--ILSSK 294 F L+C A HK ++ +G + FS ++ R+ K+L R HW +L SK Sbjct: 378 FFLACALG-DERAEHHKELLDLGREIVKKLKFSPLAAKTVGRLLKKNLTRRHWSRVLDSK 436 Query: 295 LW 300 W Sbjct: 437 EW 438 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,704,010 Number of Sequences: 37544 Number of extensions: 396816 Number of successful extensions: 793 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 774 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 792 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2279943096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -