BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30430 (828 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g03345.1 68418.m00287 expressed protein 41 0.001 At1g03230.1 68414.m00301 extracellular dermal glycoprotein, puta... 29 3.8 At1g03220.1 68414.m00300 extracellular dermal glycoprotein, puta... 28 8.7 >At5g03345.1 68418.m00287 expressed protein Length = 104 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/63 (28%), Positives = 33/63 (52%) Frame = +3 Query: 255 QEFTTLPLDIVIQAVVSLFAVMWGVLNVAGNLREIPAAAELNAIKWETQNNLPSFYIFNH 434 +EF+ P++++++ ++ L MW L G I ++ N + N+ F IFNH Sbjct: 34 EEFSRPPINVILELIIGLALCMWAALTFPGKFLSIHPDSDENRAVFLPDNS--DFMIFNH 91 Query: 435 RGK 443 RG+ Sbjct: 92 RGR 94 >At1g03230.1 68414.m00301 extracellular dermal glycoprotein, putative / EDGP, putative similar to extracellular dermal glycoprotein EDGP precursor [Daucus carota] GI:285741 Length = 434 Score = 29.1 bits (62), Expect = 3.8 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +2 Query: 266 HVTIGYCHPSCGQSVCCHVGSVECG 340 +V+ Y P C +VC GS+ CG Sbjct: 77 YVSTTYRSPRCNSAVCSRAGSIACG 101 >At1g03220.1 68414.m00300 extracellular dermal glycoprotein, putative / EDGP, putative similar to extracellular dermal glycoprotein EDGP precursor [Daucus carota] GI:285741 Length = 433 Score = 27.9 bits (59), Expect = 8.7 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +2 Query: 266 HVTIGYCHPSCGQSVCCHVGSVECG 340 +V+ Y P C +VC GS CG Sbjct: 76 YVSSTYQSPRCNSAVCSRAGSTSCG 100 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,453,278 Number of Sequences: 28952 Number of extensions: 345290 Number of successful extensions: 677 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 667 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 676 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1902108000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -