BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30429 (542 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37381| Best HMM Match : Ribosomal_S12 (HMM E-Value=0) 126 9e-30 SB_33031| Best HMM Match : Ribosomal_S12 (HMM E-Value=0) 125 3e-29 SB_3221| Best HMM Match : rve (HMM E-Value=3) 31 0.61 SB_34124| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_46453| Best HMM Match : DUF947 (HMM E-Value=0.13) 28 4.3 SB_54786| Best HMM Match : Ribosomal_S12 (HMM E-Value=1.4e-12) 27 7.5 SB_32242| Best HMM Match : Pam16 (HMM E-Value=7.4e-20) 27 9.9 SB_27475| Best HMM Match : PCMT (HMM E-Value=5.5) 27 9.9 >SB_37381| Best HMM Match : Ribosomal_S12 (HMM E-Value=0) Length = 413 Score = 126 bits (305), Expect = 9e-30 Identities = 57/66 (86%), Positives = 62/66 (93%) Frame = +2 Query: 56 NHRREQRWADKEFKKAHMGTKWKANPFGGASHAKGIVLEKVGVEAKQPNSAIRKCVRVQL 235 +HRR+Q+W DK +KKAH+GT KANPFGGASHAKGIVLEKVGVEAKQPNSAIRKCVRVQL Sbjct: 14 SHRRDQKWHDKAYKKAHLGTALKANPFGGASHAKGIVLEKVGVEAKQPNSAIRKCVRVQL 73 Query: 236 IKNGKK 253 IKNGKK Sbjct: 74 IKNGKK 79 Score = 78.2 bits (184), Expect = 4e-15 Identities = 32/40 (80%), Positives = 38/40 (95%) Frame = +1 Query: 247 KERTAFVPRDGCLNHIEENDEVLVAGFGRKGHAVGDIPGV 366 K+ TAFVP DGCLN+IEENDEVL++GFGR+GHAVGDIPG+ Sbjct: 78 KKITAFVPNDGCLNYIEENDEVLISGFGRRGHAVGDIPGI 117 >SB_33031| Best HMM Match : Ribosomal_S12 (HMM E-Value=0) Length = 143 Score = 125 bits (301), Expect = 3e-29 Identities = 57/65 (87%), Positives = 63/65 (96%) Frame = +1 Query: 247 KERTAFVPRDGCLNHIEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKEKK 426 K+ TAFVP DGCLN+IEENDEVL++GFGR+GHAVGDIPGVRFKVVKVANVSLLAL+KEKK Sbjct: 79 KKITAFVPNDGCLNYIEENDEVLISGFGRRGHAVGDIPGVRFKVVKVANVSLLALFKEKK 138 Query: 427 ERPRS 441 ERPRS Sbjct: 139 ERPRS 143 Score = 55.2 bits (127), Expect = 3e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 170 EKVGVEAKQPNSAIRKCVRVQLIKNGKK 253 ++ GVEAKQPNSAIRKCVRVQLIKNGKK Sbjct: 53 QEPGVEAKQPNSAIRKCVRVQLIKNGKK 80 >SB_3221| Best HMM Match : rve (HMM E-Value=3) Length = 324 Score = 31.1 bits (67), Expect = 0.61 Identities = 24/71 (33%), Positives = 35/71 (49%) Frame = -1 Query: 464 SLITMYTYDLGRSFFSL*RARRDTLATFTTLKRTPGMSPTA*PLRPNPATSTSSFSSMWF 285 S T TYDL SF+S+ + + LAT +K++P + + L+P A S S Sbjct: 9 SFDTFPTYDLA-SFYSVLCSGDEQLATIKLMKKSPSLFQKSHTLKPR-ANCASIASETLA 66 Query: 284 RQPSRGTNAVL 252 +Q R N VL Sbjct: 67 QQCWRSLNTVL 77 >SB_34124| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 468 Score = 29.1 bits (62), Expect = 2.5 Identities = 15/33 (45%), Positives = 18/33 (54%) Frame = +1 Query: 100 SPHGYEMEG*PFRWCISRKGHRPRESWCRS*AA 198 S HG MEG P W +S G P+ S C S +A Sbjct: 85 SQHGTRMEGVPVCWYVSVWGLSPQVSQCDSVSA 117 >SB_46453| Best HMM Match : DUF947 (HMM E-Value=0.13) Length = 943 Score = 28.3 bits (60), Expect = 4.3 Identities = 17/35 (48%), Positives = 22/35 (62%), Gaps = 3/35 (8%) Frame = -3 Query: 168 RTMPFA*D-APPKGLAFHFVPMW-AFLN-SLSAHR 73 R +PF+ APPKG F VP+W +F N S+ HR Sbjct: 902 RKVPFSSVLAPPKGYRFLIVPLWRSFSNRSVFGHR 936 >SB_54786| Best HMM Match : Ribosomal_S12 (HMM E-Value=1.4e-12) Length = 302 Score = 27.5 bits (58), Expect = 7.5 Identities = 14/32 (43%), Positives = 21/32 (65%) Frame = +2 Query: 155 KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGK 250 KG+ ++ + K+PNSA RKC ++L NGK Sbjct: 230 KGVCVKVFIRKPKKPNSAQRKCALLKL-SNGK 260 >SB_32242| Best HMM Match : Pam16 (HMM E-Value=7.4e-20) Length = 255 Score = 27.1 bits (57), Expect = 9.9 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +3 Query: 81 RTKNSRKPTWVRNGRLTLSVVHLT 152 R N++KP +R+GR+T+S+ +T Sbjct: 110 RDTNTKKPVHLRDGRVTVSLAAMT 133 >SB_27475| Best HMM Match : PCMT (HMM E-Value=5.5) Length = 63 Score = 27.1 bits (57), Expect = 9.9 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = +1 Query: 277 GCLNHIEENDEVLVAGFGRKGHA 345 G N +EEN +LV G GRKG++ Sbjct: 39 GNANLLEENRLILVTGDGRKGYS 61 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,636,831 Number of Sequences: 59808 Number of extensions: 417863 Number of successful extensions: 798 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 746 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 798 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1239956166 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -