BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30429 (542 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z70684-7|CAA94601.1| 143|Caenorhabditis elegans Hypothetical pr... 132 2e-31 Z92838-1|CAB07406.1| 157|Caenorhabditis elegans Hypothetical pr... 36 0.025 Z81128-8|CAB03402.1| 811|Caenorhabditis elegans Hypothetical pr... 29 1.6 AL132898-6|CAC14409.1| 187|Caenorhabditis elegans Hypothetical ... 28 5.0 AL132898-5|CAC14408.1| 316|Caenorhabditis elegans Hypothetical ... 28 5.0 >Z70684-7|CAA94601.1| 143|Caenorhabditis elegans Hypothetical protein F28D1.7 protein. Length = 143 Score = 132 bits (318), Expect = 2e-31 Identities = 57/65 (87%), Positives = 63/65 (96%) Frame = +2 Query: 59 HRREQRWADKEFKKAHMGTKWKANPFGGASHAKGIVLEKVGVEAKQPNSAIRKCVRVQLI 238 HR+EQRW DK +KKAH+GT+WK+NPFGGASHAKGIVLEK+GVEAKQPNSAIRKCVRVQLI Sbjct: 16 HRQEQRWNDKRYKKAHIGTRWKSNPFGGASHAKGIVLEKIGVEAKQPNSAIRKCVRVQLI 75 Query: 239 KNGKK 253 KNGKK Sbjct: 76 KNGKK 80 Score = 117 bits (282), Expect = 5e-27 Identities = 53/65 (81%), Positives = 59/65 (90%) Frame = +1 Query: 247 KERTAFVPRDGCLNHIEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKEKK 426 K+ TAFVP DGCLN +EENDEVLV+GFGR GHAVGDIPGVRFK+VKVAN SL+AL+K KK Sbjct: 79 KKITAFVPNDGCLNFVEENDEVLVSGFGRSGHAVGDIPGVRFKIVKVANTSLIALFKGKK 138 Query: 427 ERPRS 441 ERPRS Sbjct: 139 ERPRS 143 >Z92838-1|CAB07406.1| 157|Caenorhabditis elegans Hypothetical protein T03D8.2 protein. Length = 157 Score = 35.5 bits (78), Expect = 0.025 Identities = 18/32 (56%), Positives = 21/32 (65%) Frame = +2 Query: 140 GASHAKGIVLEKVGVEAKQPNSAIRKCVRVQL 235 G SH KGIVL+ V K+PNS RKC V+L Sbjct: 72 GYSHYKGIVLKTVIRHPKKPNSGNRKCAIVRL 103 >Z81128-8|CAB03402.1| 811|Caenorhabditis elegans Hypothetical protein T23D8.9a protein. Length = 811 Score = 29.5 bits (63), Expect = 1.6 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +1 Query: 253 RTAFVPRDGCLNHIEEN 303 RT FVP+DG LN I+EN Sbjct: 652 RTPFVPKDGVLNVIDEN 668 >AL132898-6|CAC14409.1| 187|Caenorhabditis elegans Hypothetical protein Y59A8B.9 protein. Length = 187 Score = 27.9 bits (59), Expect = 5.0 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 377 TLKRTPGMSPTA*PLRPNPATSTSS 303 T RTP +P A P RP P+ S+++ Sbjct: 38 TTMRTPAATPAAPPTRPTPSRSSAA 62 >AL132898-5|CAC14408.1| 316|Caenorhabditis elegans Hypothetical protein Y59A8B.7 protein. Length = 316 Score = 27.9 bits (59), Expect = 5.0 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 377 TLKRTPGMSPTA*PLRPNPATSTSS 303 T RTP +P A P RP P+ S+++ Sbjct: 167 TTMRTPAATPAAPPTRPTPSRSSAA 191 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,421,532 Number of Sequences: 27780 Number of extensions: 290848 Number of successful extensions: 686 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 637 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 686 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1091917214 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -